Labshake search
Citations for Sartorius :
101 - 150 of 244 citations for Catalase Fluorescent Activity Kit 2 Plate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... plates were scanned with a 10× objective using the Incucyte ZOOM imaging system (Sartorius, Ann Arbor, MI, USA). Normalized GFP expression (GCU ...
-
bioRxiv - Cancer Biology 2022Quote: ... 100 μL PBS per well was added and plates were imaged on an IncuCyte® S3 system (Sartorius). Fluorescence was quantified using the IncuCyte analysis software ...
-
bioRxiv - Cancer Biology 2023Quote: ... 500 cells were plated into each well of an IncuCyte® ImageLock 96-well plate (Sartorius; #BA-04856) and imaged every 30 min for a period of 48 h using a 10X objective ...
-
bioRxiv - Microbiology 2023Quote: ... well plates were imaged hourly in the IncuCyte Zoom HD/2CLR time-lapse microscopy system (Sartorius, Göttingen, Germany) equipped with an IncuCyte Zoom 10× Plan Fluor objective (Sartorius ...
-
bioRxiv - Bioengineering 2019Quote: ... and disrupted with a micro-dismembrator (Sartorius, 2×30 s at 3,000 rpm). Subsequently ...
-
bioRxiv - Molecular Biology 2021Quote: ... injection grade and passed through a 0.45 + 0.2 µm Sartopore 2 300 (Sartorius) filter for sterile filtration ...
-
bioRxiv - Molecular Biology 2021Quote: ... Buffer exchanged supernatants were filtered using 0.8 + 0.45 µm Sartopore 2 filters (Sartorius) particulate contaminant removal and further sterile filtered using 0.2 µm Sartopore 2 filters (Sartorius) ...
-
bioRxiv - Genetics 2022Quote: ... Bacterial concentration was determined by flow cytometry (Becton Dickinson LSRFortessa) such that 150,000 spirochetes per well of an ImageLock 96-well plate (Sartorius) were incubated with either 8µg/mL or 16µg/mL of variant (TP607036;MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDA PLEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCSV ...
-
bioRxiv - Cancer Biology 2023Quote: ... cells were seeded in 96 well plate in the presence of 1x Cytotox reagent (cat# ESS4633 or ESS4632; Sartorius), a highly sensitive cyanine nucleic acid dye ...
-
bioRxiv - Cancer Biology 2023Quote: ... 15,000 MDA-MB-231 cells were seeded in 96-well ImageLock plates compatible with the Incucyte Zoom system (Sartorius). 24 hours after seeding a scratch wound was made using the WoundMaker Tool (Sartorius ...
-
bioRxiv - Cancer Biology 2023Quote: ... Timelapse imaging to assess spheroid formation in round bottom ULA plates was performed using IncuCyte S3 imaging system (Sartorius). Cells were seeded in 96 well ULA plates and images every 3 hours for 48 hours ...
-
bioRxiv - Cell Biology 2024Quote: ... The plate was incubated at 37°C and 5% CO2 and imaged using an Incucyte Live-Cell imager (Sartorius). The red channel used an acquisition time of 400 milliseconds for all replicates and samples ...
-
bioRxiv - Cancer Biology 2024Quote: ... Mitochondrial membrane potential kit (Sartorius, 4775) was used for MMP measurements according to the manufacturer instructions ...
-
bioRxiv - Biochemistry 2022Quote: ... concentrated to 7.1 mg/ml with a 100-kDa MWCO Vivaspin 2 concentrator (Sartorius), frozen in liquid nitrogen ...
-
bioRxiv - Biochemistry 2021Quote: ... ultrafiltration was performed using Vivaspin 15 and Vivaspin 2 Hydrosart devices (Sartorius Stedim Biotech) of 2-kDa molecular-mass cutoff ...
-
bioRxiv - Systems Biology 2021Quote: ... A 2 L bioreactor equipped with a Sartorius BIOSTAT B® fermentation controller (Sartorius Stedim Biotech GmbH ...
-
bioRxiv - Molecular Biology 2021Quote: ... particulate contaminant removal and further sterile filtered using 0.2 µm Sartopore 2 filters (Sartorius), then divided into four parts for further processing ...
-
bioRxiv - Cell Biology 2023Quote: ... Beads were separated using clarifying filters (2000 x g, 2 minutes; Vivaclear Mini, Sartorius).
-
bioRxiv - Microbiology 2023Quote: ... filtered through a slow filter paper (#293; 1–2 µm Sartorius, Thermo Fisher Scientific), and then used to determine electrical conductivity (EC) ...
-
bioRxiv - Bioengineering 2023Quote: ... After sterile filtration through 0.45|0.2-micron PES Sartopore 2 filter (Sartorius Stedim, Germany) the formulated bulk sample was collected in 3 L Flexboy 2D bag (Sartorius Stedim ...
-
bioRxiv - Biophysics 2024Quote: ... His-tagged dROS1 protein (construct 2-3) were loaded onto penta-His sensors (Sartorius) to a response unit of about 0.5 nm followed by quenching in 10 ng/mL biocytin (Sigma-Aldrich ...
-
bioRxiv - Genetics 2021Quote: ... Neuronal migration was measured during a 70-hour period from day 40 by transferring cell culture plates to the IncuCyte Live Cell Analysis System (Sartorius). Cells were maintained at 37°C and 5% CO2 with 20X magnification phase contrast images taken of whole wells in every 2 hours for the analysis period ...
-
bioRxiv - Cancer Biology 2022Quote: ... GFP-NANOG MDA-MB-231 cells were plated on fibronectin-coated (30 μg/mL) glass 96 well plates and placed in an Incucyte S3 (Sartorius) live cell imaging system ...
-
bioRxiv - Cancer Biology 2022Quote: ... Basolateral compartments were filled with culture medium containing 10% FBS and plates were placed in an Incucyte S3 Imaging System (Sartorius). Images of the apical and basolateral sides of the porous membrane were captured every 4 hours over 3 days ...
-
bioRxiv - Cancer Biology 2019Quote: TNBC control and gene knocked down cells (500/well) were seeded in 384 well plate and transferred to Incucyte ZOOM analysis system (Sartorius) that was maintained at 37 °C ...
-
bioRxiv - Developmental Biology 2022Quote: ... cells were grown on a 96-well plate and placed in the incubated chamber of an Incucyte ZOOM Microscope (Sartorius). EpiLC differentiation medium was added and supplemented with 5µM of Caspase 3/7 Green dye (Sartorius ...
-
bioRxiv - Cancer Biology 2022Quote: ... 5 x 104 cells were seeded in each well of an Incucyte® ImageLock 96-well plate (Sartorius, Catalog #: 4379) in 100 μL/well of either complete RPMI or DMEM ...
-
bioRxiv - Genetics 2023Quote: ... 500 cells were seeded in duplicates in 96-well plates and treated with 1 µg/ml dox for 9-10 days and analyzed with Incucyte (Sartorius). Untreated cells served as reference.
-
bioRxiv - Cancer Biology 2023Quote: ... 7500 cells per genotype were seeded in 96-well plates in both media conditions and proliferation was monitored via the IncuCyte Zoom imaging platform (Sartorius) for up to 72 hours ...
-
bioRxiv - Immunology 2023Quote: HeLa and MDA-MB-231 WT and ARPC5-KO cells were seeded in a 96-well ImageLock plate (Sartorius #4806) and incubated for 24 h ...
-
bioRxiv - Neuroscience 2023Quote: ... Octet® SAX high precision streptavidin biosensors and Octet® 384TW tilted-bottom plates were purchased from Sartorius (Göttingen, Germany). Peptides were synthesized by GenScript (Piscataway ...
-
bioRxiv - Microbiology 2023Quote: ... Plates of infected macrophages were imaged in triplicate per well in an Incucyte S3 Live-Cell Analysis Platform (Sartorius #4647). Phase and fluorescence images were collected every hour per well using a 20X objective ...
-
bioRxiv - Molecular Biology 2023Quote: ... 3–5 x103 cells were seeded in 96-well plates and viable cell numbers were determined using the Incucyte (Sartorius) Adherent-Cell-by-Cell module ...
-
bioRxiv - Immunology 2024Quote: ... Plates were imaged every 4-6 hours for 3-7 days using the IncuCyte® Live-Cell Analysis System (Sartorius). 5 images per well at 10x zoom were collected at each time point ...
-
bioRxiv - Neuroscience 2024Quote: ... Well plates then immediately underwent imaging with an Incucyte SX5 equipped with a SX5 G/O/NIR optical module (Sartorius). Quantifications were conducted with the systems onboard analysis software.
-
bioRxiv - Cancer Biology 2023Quote: ... 2.5 x 103 cells/well were plated in FBS-free media in the upper chamber of a 96-well Incucyte ClearView cell migration plate (8 µm pore size; #4582 Sartorius). Cells were incubated at 37°C for 45 minutes to allow cells to settle on the membrane before adding RPMI-1640 media supplemented with 10% FBS to the bottom chamber ...
-
bioRxiv - Immunology 2024Quote: ... The mixture was gently resuspended for 60 sec and 50 µl were added in a 96 well image lock plate (Sartorius) on ice ...
-
bioRxiv - Immunology 2024Quote: ... The collagen suspension was mixed carefully with the cells in a ratio of 4:1 and 50 µl were added in a 96 well image lock plate (Sartorius) on ice ...
-
bioRxiv - Cancer Biology 2019Quote: ... Two peaks were collected and concentrated on a 2 mL Vivaspin 10 MWCO (Sartorius, UK). The molecular sizes of peak 1 (300 kDa ...
-
bioRxiv - Microbiology 2019Quote: ... 2 mM MgSO4) and concentration of the sample using Vivaspin6 5 kDa MWCO concentrators (Sartorius).
-
bioRxiv - Molecular Biology 2022Quote: ... 42 and 63 days were concentrated using 2 ml Vivaspin concentrator columns (Sartorius, Göttingen, Germany) by centrifuging at 1,000g until the final volume was 100 μl and subsequently centrifuged into the column cap at 4,000g for 2 min ...
-
bioRxiv - Biochemistry 2024Quote: ... The supernatant from this second spin step was subsequently passed through 2 0.22µm filters (Sartorius) and made up to 500 ml with 50 mM ammonium acetate buffer at pH 5 before loading onto a 30 mL SP Sepharose column (Cytiva) ...
-
bioRxiv - Cancer Biology 2022Quote: 700 cancer and 1400 stellate cells were seeded in culture medium containing 1% FBS into the apical compartment of an Incucyte Clearview 96-well plate (Sartorius, 4582) at a 1:2 ratio ...
-
bioRxiv - Cancer Biology 2023Quote: 2,000 cells per well were plated in 96-well plates and treated with the indicated dose of drugs or caspase-3/7 dye for apoptosis (Sartorius, #4440). Cell proliferation and apoptosis were monitored by a microscope gantry that was connected to a network external controller hard drive that gathered and processed image data ...
-
bioRxiv - Cancer Biology 2023Quote: ... 25 µl of single-cell suspension was dispensed on ready-to-use plates with an 8-channel electronic Picus® pipette (10 to 300 µl, #735361, Sartorius).
-
bioRxiv - Developmental Biology 2024Quote: ... and 100,000 cells were resuspended in growth factor-free CNCC early maintenance media and seeded in an IncuCyte ImageLock 96-well plate (Sartorius 4379) in triplicate and incubated for 48 hours at 37°C ...
-
bioRxiv - Cell Biology 2024Quote: ... was diluted to 50ug/mL in DPBS to coat the top and bottom sides of the inserts of an Incucyte Clearview 96-well plate (Sartorius: 4582). After 1h ...
-
bioRxiv - Cell Biology 2023Quote: The XTT cell proliferation kit (BioInd, SARTORIUS) was performed according to the manufactural protocol ...
-
bioRxiv - Bioengineering 2024Quote: ... The plate was centrifuged for 5 minutes at 100g and then placed in the IncuCyte S3 Live-Cell Analysis System (Sartorius, G_ttingen, Germany) and stored at 37°C ...
-
bioRxiv - Bioengineering 2021Quote: Bioreactor cultivation was performed as duplicates in 2 L Biostat B-DCU bioreactors (Sartorius AG, Germany) with a working volume of 1.5 L ...