Labshake search
Citations for Agilent :
551 - 600 of 773 citations for SARS Coronavirus Nucleoprotein N Term E. coli since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2021Quote: Plasmids encoding the single-mutation and the combination of mutations found in SARS-CoV-2 variants were generated by Quikchange II XL site-directed mutagenesis kit (Agilent). Recombinant Indiana vesicular stomatitis virus (VSV ...
-
bioRxiv - Microbiology 2022Quote: ... ORF6 mutations were introduced into the pLVX-StrepII-SARS-CoV-2-ORF6-IRES-Puro and pLVX-EF1α-SARS-CoV-2-ORF6-2xStrep-IRES-Puro plasmids using the QuickChange II-XL site-directed mutagenesis kit (Agilent) according to the manufacturer’s instructions using SDM primers listed below ...
-
bioRxiv - Immunology 2022Quote: ... viral protein in the virus-infected cells was detected by ELISA assay using anti-SARS-CoV-2 nucleocapsid mAb (40143-R001, SinoBiological) and HRP-conjugated goat anti-rabbit pAb (P0448, Dako). After 10 min incubation with TMB substrate ...
-
bioRxiv - Microbiology 2020Quote: ... A series of alanine mutants were introduced into the SARS-CoV-2 spike protein using the QuickChange mutagenesis kit or the QuickChange multi-mutagenesis kit (Agilent). The primers for mutagenesis were designed on Agilent’s website (https://www.agilent.com/store/primerDesignProgram.jsp) ...
-
bioRxiv - Microbiology 2021Quote: ... D950N) were prepared from wild-type SARS-CoV-2 spike using the QuickChange Lighting Multi Site-directed Mutagenesis kit (Agilent). Additional RBD mutations were introduced into the Delta spike also using the QuickChange Lighting Multi Site-directed Mutagenesis kit (Agilent) ...
-
bioRxiv - Genomics 2021Quote: ... the initial concentrations of purified SARS-CoV-2 and the universal human reference RNA (UHRR, Agilent Technologies, product number 740000) were determined by ddPCR as described above ...
-
bioRxiv - Immunology 2022Quote: ... SARS-COV-2-Strunc variants were generated in house by site-directed mutagenesis (QuikChange Multi Site-Directed Mutagenesis Kit, Agilent) starting from synthetic DNA (Genscript) ...
-
bioRxiv - Microbiology 2023Quote: ... were prepared and stained with hematoxylin eosin (HE) for histological examination or subjected to immunohistological staining to detect SARS-CoV-2 antigen (performed in an autostainer; Agilent), using the horseradish peroxidase (HRP ...
-
bioRxiv - Biophysics 2023Quote: GST-His9-SARS-CoV2 NTD-RBDL and NTDL-RBD Nucleocapsid constructs were expressed recombinantly in Gold BL21(DE3) cells (Agilent). 4 L cultures were grown in LB medium with carbenicillin (100 ug/mL ...
-
bioRxiv - Cell Biology 2021Quote: ... The E-box mutant was constructed with QuikChange II XL Site-Directed Mutagenesis Kit (Agilent Technologies) using primers 5’-cgcgggttcccaccttgtggccagaagatcttctgggcagaactactcgtttggc-3’ and 5’-gccaaacgagtagttctgcccagaagatcttctggccacaaggtgggaacccgcg-3’ ...
-
bioRxiv - Microbiology 2022Quote: ... RTCA E-plate VIEW 16 plates with embedded golden electrodes (#300600880, Agilent, Santa Clara, CA, USA) were used for the experiments ...
-
bioRxiv - Cancer Biology 2023Quote: ... The tissues were stained using H&E or a primary antibody against Ki67 (GA626, Dako Omnis) and an HRP-labeled secondary antibody (Abcam) ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1 x 104 tumor cells were plated per well in a 96-well E-plate (Agilent), and impedance is read for 16 hours during incubation ...
-
bioRxiv - Neuroscience 2020Quote: ... Sections were coverslipped using Di-N-Butyle Phthalate in xylene (DPX, Dako).
-
bioRxiv - Microbiology 2020Quote: ... 0.4μg of M and 0.8μg of N) using GeneJammer transfection reagent (Agilent). Medium was replaced 16h post-transfection ...
-
bioRxiv - Neuroscience 2022Quote: ... followed by O/N incubation of primary antibody (GFAP (1:500, Dako) in 2% BSA ...
-
bioRxiv - Neuroscience 2021Quote: ... and the quality of the libraries were performed on a 2100 Bioanalyzer from Agilent using an Agilent High Sensitivity DNA kit (Agilent P/N 5067-4626). Sequencing libraries were loaded at 10 to 12pM on an Illumina HiSeq2500 with 2 × 50 paired-end kits using the following read length ...
-
bioRxiv - Genomics 2020Quote: ... Each pool (2nM per library; Agilent SureSelect XT HS, n=6; Agilent SureSelect XT RNA Direct ...
-
bioRxiv - Cell Biology 2022Quote: ... Data analysis: PNGase F released free N-glycan was identified by Agilent Masshunter Quantitative Analysis software by the presence of hexose and N-acetylhexosamine ...
-
bioRxiv - Immunology 2021Quote: ... embedded in paraffin, and automatically stained for SARS-CoV-2 (2019-nCoV) Nucleocapsid (SINO BIO, #40143-R019) or for fibrin (DAKO, #A0080) through LEICA BOND RX 1h room- temperature (RT ...
-
bioRxiv - Microbiology 2023Quote: Site-directed mutagenesis of SARS-CoV-2 spike was performed with the QuikChange II XL Site-Directed Mutagenesis Kit (Agilent 200522), using primers listed in Supplementary table S2 and according to manufacturer’s instructions ...
-
bioRxiv - Biochemistry 2021Quote: ... All AtAtm3 constructs were overexpressed in Escherichia coli BL21-gold (DE3) cells (Agilent Technologies, CA) using ZYM-5052 autoinduction media as described previously (Fan et al. ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: The nsp14 and nsp10 proteins were expressed in Escherichia coli BL21-CodonPlus(DE3)-RIL (Stratagene). The bacteria were grown in Luria–Bertani medium supplemented with 50 mg/mL kanamycin at 37 °C to an OD600 of 0.6 ...
-
bioRxiv - Biochemistry 2020Quote: ... coli cells by the heat-shock approach as described in the supplier’s manual (Novagen/Agilent) and by antibiotic selection using Zeocin (Invitrogen/ThermoFisher) ...
-
bioRxiv - Cell Biology 2019Quote: ... Proteins were expressed in BL21-CodonPlus (DE3)-RIL Escherichia coli (Agilent Technologies, catalog no. 230245) at 37°C with 0.25 mM IPTG (Isopropyl β-D-1-thiogalactopyranoside ...
-
bioRxiv - Microbiology 2021Quote: All transformations for cloning or plasmid amplification were performed in Escherichia coli XL10 Gold (Agilent) according to manufacturer’s instructions.
-
bioRxiv - Biophysics 2022Quote: ... Aβ40/Aβ42 was expressed in the Escherichia coli BL21Gold (DE3) strain (Stratagene, La Jolla, CA) and purified by sonication and dissolving the inclusion bodies in 8 M urea ...
-
bioRxiv - Plant Biology 2023Quote: ... Substrate proteins were induced and expressed in Escherichia coli BL21 CodonPlus(DE3)-RIL cells (Stratagene) over night at 18°C after induction with 1 mM IPTG ...
-
bioRxiv - Neuroscience 2022Quote: ... The insert was verified by sequencing and then transformed into BL21 Escherichia coli strain (Stratagene) for expression ...
-
bioRxiv - Neuroscience 2023Quote: ... All other proteins were expressed in Escherichia coli BL21-CodonPlus(DE3)-RIL cells (Agilent Technologies) in LB medium at 16 □ overnight ...
-
bioRxiv - Genetics 2021Quote: ... The obtained chromatograms were analyzed with the software Enhanced Chemstation E.01.00.237 (Agilent, Santa Clara, CA, USA). Peak identification was carried out automatically with the initial area reject parameter set to 0 ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: E-cigarette liquids were diluted 100X into spectral grade methanol and injected into the GCMS detector (Agilent 7890A gas chromatograph with 5975 MSD detector) ...
-
bioRxiv - Biochemistry 2020Quote: ... All E protein variants were obtained by site-directed mutagenesis using QuikChange kit (Stratagene, La Jolla, California) and were confirmed by sequencing the plasmid DNA at Macrogen Company (Seoul ...
-
bioRxiv - Biophysics 2022Quote: ... Relative permittivity and electrical conductivity were measured using a dielectric probe kit (85070 E, Agilent Tech. Inc.) for a range of frequency between 950 MHz and 2400 MHz and heat capacitance was measured using a KD2 thermal properties analyzer (Decagon Devices Inc.).
-
bioRxiv - Biophysics 2022Quote: ... Relative permittivity and electrical conductivity were measured using a dielectric probe kit (85070 E, Agilent Tech. Inc.) for a range of frequency between 950 MHz and 2400 MHz and heat capacitance was measured using a KD2 thermal properties analyzer (Decagon Devices Inc.).
-
bioRxiv - Immunology 2022Quote: ... Each sample slide was stained with H&E (Hematoxylin Dako #S3309, Eosin, Dako #CS701, bluing buffer #CS702) and the brightfield images were captured via Leica whole-slide scanner at 10X resolution.
-
bioRxiv - Plant Biology 2023Quote: ... mass calibrant using the “atune.u” autotune method provided with Agilent GC/MSD Productivity ChemStation Software (Revision E.02.01.1177; Agilent Technologies ...
-
bioRxiv - Immunology 2021Quote: Point substitutions within RBD in SARS-CoV-2 spike gene were introduced by site-directed mutagenesis using the QuikChange II kit (Agilent Technologies Inc.) following the manufacturer’s protocol and by overlapping PCR strategy as described previously (Patil et al. ...
-
bioRxiv - Microbiology 2021Quote: ... were designed based on the DNA sequence for SARS-CoV-2 Wuhan-Hu-1 using the QuickChange Primer Design tool (Agilent Technologies, Inc.). Mutagenesis was carried out on a pCDNA-SARs2 Wuhan-Hu 1 S plasmid to create the P681H mutation ...
-
bioRxiv - Biophysics 2022Quote: Point substitutions within RBD in SARS-CoV-2 spike gene were introduced by site-directed mutagenesis using the QuikChange II kit (Agilent Technologies Inc.) following the manufacturer’s protocol and by overlapping PCR strategy as described previously (33) ...
-
bioRxiv - Biochemistry 2019Quote: ... followed by addition of 0.5μL of OPA dye (Agilent P/N 5061-3335). Finally ...
-
bioRxiv - Biochemistry 2022Quote: ... Samples were first treated by non-denaturing release overnight with N-glycanase (Prozyme) at 37°C and ...
-
bioRxiv - Biophysics 2021Quote: Aβ42 (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA) was expressed recombinantly in the Escherichia coli BL21 Gold (DE3) strain (Stratagene, CA, USA), and purified as described previously15 ...
-
Mechanical forces impair antigen discrimination by reducing differences in T cell receptor off-ratesbioRxiv - Immunology 2022Quote: ... TCR α and β chains were expressed in BL21 (DE3)-RIPL Escherichia coli cells (Agilent Technologies) following induction with 0.15 mM IPTG ...
-
bioRxiv - Biophysics 2019Quote: ... Escherichia coli XL10-Gold and BL21(DE3) Gold cells were purchased from STRATAGENE (San Diego, CA). 6-Acryloyl-2-Dimethylaminonaphthalene (Acrylodan) ...
-
bioRxiv - Biophysics 2020Quote: ... were prepared by expression in Escherichia coli BL21 (DE3) Gold Strain (Agilent Technologies, Santa Clara, USA)46 ...
-
bioRxiv - Neuroscience 2020Quote: ... All recombinant proteins were expressed in the BL21-Gold (DE3) pLysS strain of Escherichia coli (Agilent) in pGEX-KG vectors as glutathione S-transferase (GST ...
-
bioRxiv - Biochemistry 2022Quote: ... coli LacI DBD (1121 variants in total) were synthesized as single-stranded oligonucleotide pools (Agilent Technologies). Extant DBDs exceeding 60aa long were truncated from the N-terminus to 60 residues in length to comply with DNA synthesis restrictions ...
-
bioRxiv - Biochemistry 2023Quote: ... SUV420H1 plasmid was transformed into Escherichia coli BL2-codon plus (DE3)-RIL competent cells (Agilent technologies) and grown in 2xYT-Kan media ...
-
bioRxiv - Cell Biology 2023Quote: ... and the expression vector was introduced into an Escherichia coli strain BL21-CodonPlus (DE3)-RIL (Agilent). The transformed bacterial cells were grown at 37°C until OD600 reached 0.7 ...