Labshake search
Citations for Agilent :
551 - 600 of 1141 citations for Human Coronavirus 229E Nucleoprotein E. coli since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: ... rabbit anti-human C3d (1:200; Dako), and rabbit anti-human C5b-9 (1:200 ...
-
bioRxiv - Immunology 2023Quote: ... mouse α-human CD20 (clone L26, Dako), rabbit α-CD3 (SP7 ...
-
bioRxiv - Genomics 2023Quote: ... Universal Human Reference RNA (740000, Agilent Technologies) and Human Brain Reference RNA (QS0611 ...
-
bioRxiv - Genetics 2021Quote: ... The obtained chromatograms were analyzed with the software Enhanced Chemstation E.01.00.237 (Agilent, Santa Clara, CA, USA). Peak identification was carried out automatically with the initial area reject parameter set to 0 ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: E-cigarette liquids were diluted 100X into spectral grade methanol and injected into the GCMS detector (Agilent 7890A gas chromatograph with 5975 MSD detector) ...
-
bioRxiv - Biochemistry 2020Quote: ... All E protein variants were obtained by site-directed mutagenesis using QuikChange kit (Stratagene, La Jolla, California) and were confirmed by sequencing the plasmid DNA at Macrogen Company (Seoul ...
-
bioRxiv - Biophysics 2022Quote: ... Relative permittivity and electrical conductivity were measured using a dielectric probe kit (85070 E, Agilent Tech. Inc.) for a range of frequency between 950 MHz and 2400 MHz and heat capacitance was measured using a KD2 thermal properties analyzer (Decagon Devices Inc.).
-
bioRxiv - Biophysics 2022Quote: ... Relative permittivity and electrical conductivity were measured using a dielectric probe kit (85070 E, Agilent Tech. Inc.) for a range of frequency between 950 MHz and 2400 MHz and heat capacitance was measured using a KD2 thermal properties analyzer (Decagon Devices Inc.).
-
bioRxiv - Immunology 2022Quote: ... Each sample slide was stained with H&E (Hematoxylin Dako #S3309, Eosin, Dako #CS701, bluing buffer #CS702) and the brightfield images were captured via Leica whole-slide scanner at 10X resolution.
-
bioRxiv - Plant Biology 2023Quote: ... mass calibrant using the “atune.u” autotune method provided with Agilent GC/MSD Productivity ChemStation Software (Revision E.02.01.1177; Agilent Technologies ...
-
bioRxiv - Biophysics 2021Quote: Aβ42 (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA) was expressed recombinantly in the Escherichia coli BL21 Gold (DE3) strain (Stratagene, CA, USA), and purified as described previously15 ...
-
Mechanical forces impair antigen discrimination by reducing differences in T cell receptor off-ratesbioRxiv - Immunology 2022Quote: ... TCR α and β chains were expressed in BL21 (DE3)-RIPL Escherichia coli cells (Agilent Technologies) following induction with 0.15 mM IPTG ...
-
bioRxiv - Biophysics 2019Quote: ... Escherichia coli XL10-Gold and BL21(DE3) Gold cells were purchased from STRATAGENE (San Diego, CA). 6-Acryloyl-2-Dimethylaminonaphthalene (Acrylodan) ...
-
bioRxiv - Biophysics 2020Quote: ... were prepared by expression in Escherichia coli BL21 (DE3) Gold Strain (Agilent Technologies, Santa Clara, USA)46 ...
-
bioRxiv - Neuroscience 2020Quote: ... All recombinant proteins were expressed in the BL21-Gold (DE3) pLysS strain of Escherichia coli (Agilent) in pGEX-KG vectors as glutathione S-transferase (GST ...
-
bioRxiv - Biochemistry 2022Quote: ... coli LacI DBD (1121 variants in total) were synthesized as single-stranded oligonucleotide pools (Agilent Technologies). Extant DBDs exceeding 60aa long were truncated from the N-terminus to 60 residues in length to comply with DNA synthesis restrictions ...
-
bioRxiv - Biochemistry 2023Quote: ... SUV420H1 plasmid was transformed into Escherichia coli BL2-codon plus (DE3)-RIL competent cells (Agilent technologies) and grown in 2xYT-Kan media ...
-
bioRxiv - Cell Biology 2023Quote: ... and the expression vector was introduced into an Escherichia coli strain BL21-CodonPlus (DE3)-RIL (Agilent). The transformed bacterial cells were grown at 37°C until OD600 reached 0.7 ...
-
Sex Differences in Brain Tumor Glutamine Metabolism Reveal Sex-Specific Vulnerabilities to TreatmentbioRxiv - Cancer Biology 2021Quote: Derivatized samples were run on an Agilent 7890A GC coupled to an Agilent 5975C MS and data was acquired and analyzed in MSD ChemStation E.02.02.1431 (Agilent). The GC temperature program was set to ...
-
bioRxiv - Cell Biology 2021Quote: ... cells were resuspended in DMEM with 10% of FCS and transferred into xCELLigence microplates (E-plate 16, Agilent) at the density of 20 000 cells for real-time analysis of cell adhesion and growth ...
-
bioRxiv - Cancer Biology 2022Quote: ... and fixed with precooled methyl alcohol in −20℃ for 30 min followed by H&E staining (Eosin, Dako CS701 ...
-
Sex Differences in Brain Tumor Glutamine Metabolism Reveal Sex-Specific Vulnerabilities to TreatmentbioRxiv - Cancer Biology 2021Quote: Derivatized samples were run on an Agilent 7890A GC coupled to an Agilent 5975C MS and data was acquired and analyzed in MSD ChemStation E.02.02.1431 (Agilent). The GC temperature program was set to ...
-
bioRxiv - Neuroscience 2022Quote: ... Derivatized samples were run on an Agilent 7890A GC coupled to an Agilent 5975C MS and data was acquired and analyzed in MSD ChemStation E.02.02.1431 (Agilent). The GC temperature program was set to ...
-
bioRxiv - Systems Biology 2023Quote: ... The cells were plated at 15,000 cells/well onto fibronectin-coated (5 μg/cm2) xCELLigence E-plate (Agilent) wells in serum free medium ...
-
bioRxiv - Cancer Biology 2023Quote: ... 30,000 LM7 or LM7-KO cells were added to each well of a 96 well E-Plate (Agilent) in complete RPMI ...
-
bioRxiv - Cancer Biology 2022Quote: ... All tissue slices were routinely stained with hematoxylin and eosin (H&E) using the Dako Coverstainer (Agilent Technologies) and were reviewed by an experienced pathologist ...
-
bioRxiv - Microbiology 2023Quote: Cells were seeded at 3,000 cells/well in 150 μL of complete media (above) in E-plates (Agilent) and grown overnight while being monitored with an xCELLigence SP system (Agilent) ...
-
bioRxiv - Plant Biology 2023Quote: ... Raw GC/MS files were exported to NetCDF format using Agilent MSD ChemStation software (Revision E.02.01.1177; Agilent Technologies ...
-
bioRxiv - Bioengineering 2023Quote: ... ITO slides were then stained for H&E and imaged using the Cytation 5 (Agilent, Santa Clara, CA) and Epsilon scanner at 3000 dpi to select regions of interest using the open-source program ...
-
bioRxiv - Neuroscience 2023Quote: ... followed by staining with hematoxylin and eosin (H&E) (Eosin, Dako CS701, Hematoxylin Dako S3309, bluing buffer CS702). The brightfield images were taken on a Leica DMI8 whole-slide scanner at 10x resolution.
-
bioRxiv - Microbiology 2020Quote: FITC-conjugated rabbit F(ab’)2 anti-human C1q was obtained by digestion of FITC-conjugated rabbit anti-human C1q (Dako) using 1 U/ µg of recombinant His-tagged IdeS protease ...
-
bioRxiv - Cancer Biology 2020Quote: ... mononuclear cells were screened accordingly to the method for human DCCs using immunofluorescent staining of the cell suspension with anti-human EpCAM (Ber-EP4-FITC, Agilent, or HEA-125-PE ...
-
bioRxiv - Genomics 2020Quote: The Universal Human Reference RNA was from Agilent Technologies ...
-
bioRxiv - Immunology 2021Quote: ... rabbit antibody against anti-human MPO (A0398, Dako), mouse β actin (A1978 ...
-
bioRxiv - Cell Biology 2019Quote: ... Primary antibodies against human tau (DAKO Cat# A0024) and β-actin (Cell Signaling Cat# 3700 ...
-
bioRxiv - Immunology 2020Quote: ... mouse-anti-human EGFR (Dako, DAK-H1-WT), and CLTX-biotin ...
-
bioRxiv - Genomics 2019Quote: ... Library construction (Agilent SureSelect Human All Exon kit), quality assessment ...
-
bioRxiv - Genomics 2019Quote: ... SureSelectXT Human all exon V6 kit (Agilent Technologies) was used to capture exons ...
-
bioRxiv - Neuroscience 2020Quote: ... human embryonic kidney cells 293 (HEK293; Agilent #240073) were calcium phosphate-transfected with the recombinant AAV2 plasmid and a 3-helper system ...
-
bioRxiv - Neuroscience 2022Quote: ... Rabbit anti–human vWF (A0082, Agilent, 1:300). Primary antibodies were detected with the corresponding Alexa Fluor -555 ...
-
bioRxiv - Immunology 2022Quote: ... and mouse anti-human CD68 (Dako, M087601-2) and rabbit anti-human PD-L1 (Ventana ...
-
bioRxiv - Bioengineering 2022Quote: ... human CD31 (mouse, 1:200, clone JC70A, Agilent), mouse CD31 (rat ...
-
bioRxiv - Cancer Biology 2022Quote: ... IHC for human Ki67 (IR62661-2, Agilent Technologies) was used to ensure the propagated tumors were comprised of human cells ...
-
bioRxiv - Cancer Biology 2020Quote: ... Monoclonal mouse anti-human Ki67 was from Dako Agilent Technologies (Les Ulis ...
-
bioRxiv - Genomics 2019Quote: ... Universal Human Reference RNA was purchased from Agilent Technologies (#740000 ...
-
bioRxiv - Biophysics 2019Quote: The human embryonic kidney AD-293 cells (Agilent) were cultured in growth medium that consisted of Dulbecco’s modified Eagle’s medium (DMEM ...
-
bioRxiv - Cancer Biology 2021Quote: ... A SureSelectXT Human All Exon V6 kit (Agilent) was used for exome capture ...
-
bioRxiv - Immunology 2022Quote: ... A whole Human Genome Microarray 4X44K (Agilent Technologies) was used for gene expression analysis ...
-
bioRxiv - Pharmacology and Toxicology 2022Quote: ... human vimentin (1:4,000; M0725; DakoCytomation; Glostrup, Denmark), P-gp (1:200 ...
-
bioRxiv - Neuroscience 2022Quote: ... Rabbit anti-human GFAP (1:400, Dako, Z0334), Rabbit anti-human SLC1A3 (1:500 ...