Labshake search
Citations for Agilent :
351 - 400 of 2902 citations for Leptospira Biflexa Antigen Strain Patoc 1 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Developmental Biology 2023Quote: ... Antigen retrieval was performed in DAKO PT Link in a DAKO Target Retrieval (Low pH) Solution (DAKO, Cat# S1699) at 98°C for 30 min ...
-
bioRxiv - Neuroscience 2023Quote: ... slices underwent an antigen retrieval step at 95C (for 30 minutes followed by gradual cooling per the manufacturer’s instructions; DAKO) prior to permeabilization and blocking to improve antigenicity.
-
bioRxiv - Cell Biology 2022Quote: ... The expression of the GST-GAP fusion protein in E.coli strain BL-21-RILP (Stratagene) and its purification using Glutathione Sepharose 4B were performed as described previously (Jung et al. ...
-
bioRxiv - Molecular Biology 2022Quote: Recombinant production/purification: The MLucV construct was expressed in BL21-CodonPlus (DE3)-RIPL strain (Agilent) using ampicillin and chloramphenicol as the selection antibiotic ...
-
bioRxiv - Molecular Biology 2022Quote: ... 2 ng DNA was transformed into the Validation Reporter (VR) strain (Agilent Technologies #200192; discontinued) to obtain 30-40 million transformants using electroporation ...
-
bioRxiv - Biophysics 2022Quote: ... Aβ40/Aβ42 was expressed in the Escherichia coli BL21Gold (DE3) strain (Stratagene, La Jolla, CA) and purified by sonication and dissolving the inclusion bodies in 8 M urea ...
-
bioRxiv - Neuroscience 2022Quote: ... The insert was verified by sequencing and then transformed into BL21 Escherichia coli strain (Stratagene) for expression ...
-
bioRxiv - Cancer Biology 2021Quote: Immunohistochemical staining of formalin-fixed, paraffin-embedded xenografts was performed after antigen retrieval (120°C, 7 min at pH9) and peroxidase blocking (Dako) using the UltraVision LP detection system (Thermo Fisher Scientific ...
-
bioRxiv - Developmental Biology 2019Quote: ... Brain sections that were stained with antibodies that required antigen retrieval were incubated in Dako 1X target retrieval solution (Agilent Dako) or sodium acetate buffer ...
-
bioRxiv - Immunology 2019Quote: ... Epithelial cells in the EDTA fraction were depleted by incubation with anti-human epithelial antigen antibody (clone Ber-EP4, Dako) followed by anti-mouse IgG dynabeads (ThermoFisher ...
-
bioRxiv - Cancer Biology 2020Quote: ... France) Citrate buffer pH6 was used for antigen retrieval 20min à 96°C (Target Retrieval so-lution low pH, Dako) and DAB and Hematoxylin staining were revealed using ImPath detection kit (DAB OB Sensitive Detection Kit ...
-
bioRxiv - Bioengineering 2020Quote: ... rehydrated slides were subject to antigen retrieval using citric acid buffer at 120°C and 20 psi in a pressure cooker (DAKO). Afterwards ...
-
bioRxiv - Cancer Biology 2021Quote: ... for 30 min or with 0.4 µg/ml anti-human cath-D mouse monoclonal antibody (clone C-5) for 20 min after heat-induced antigen retrieval with the PTLink pre-treatment (Dako) and the High pH Buffer (Dako ...
-
bioRxiv - Neuroscience 2022Quote: ... Human brain sections were rehydrated and antigen demasking was done using EnVisionTM FLEX Target Retrieval Solution (Agilent Technologies, pH 9.0) under heat ...
-
bioRxiv - Cancer Biology 2022Quote: ... Samples were subjected to antigen retrieval (Sodium Citrate 10mM, pH=6.0) followed by washing with PBS and incubation in hydrogen peroxide (Dako, #S2003) to inhibit endogenous peroxidase ...
-
bioRxiv - Cancer Biology 2022Quote: ... Samples were subjected to antigen retrieval (Sodium Citrate 10mM, pH=6.0) followed by washing with PBS and incubation in hydrogen peroxide (Dako, #S2003) to inhibit endogenous peroxidase ...
-
bioRxiv - Cancer Biology 2021Quote: Biopsy sections were deparaffinized and antigens were retrieved by boiling in 10mM sodium citrate buffer pH6 for 40 minutes followed by endogenous biotin blocking (Agilent) and normal goat serum blocking (Sigma-Aldrich) ...
-
bioRxiv - Immunology 2019Quote: ... Antigen retrieval was performed either with Proteinase K (for F4/80) or boiling the sections in a high pH antigen retrieval buffer (Dako Target retrieval Solution ...
-
bioRxiv - Microbiology 2021Quote: ... Specific antigen-antibody reactions were visualized by means of 3,3’-diaminobenzidine tetrahydrochloride staining using the Dako Envision system (Dako Cytomation).
-
bioRxiv - Immunology 2019Quote: ... Epithelial cells in the EDTA fraction were depleted by incubation with anti-human epithelial antigen antibody (clone Ber-EP4, Dako) followed by anti-mouse IgG dynabeads (ThermoFisher ...
-
bioRxiv - Cancer Biology 2021Quote: ... the slides were subjected to staining with F4/80 and CSF1R antibodies (cycle zero, no antigen retrieval, Table S3) and hematoxylin staining (S3301, Dako) for 1-5mins followed by whole slide scanning ...
-
bioRxiv - Cancer Biology 2022Quote: ... and antigen retrieval was performed by heat-induced epitope retrieval (HIER) in Dako PT Link with a high pH buffer (Dako). The staining was performed with an autostainer (Autostainer Link 48 ...
-
bioRxiv - Cancer Biology 2022Quote: ... Sections were subjected to heat-induced antigen retrieval by incubation in a low pH buffer (Envision Flex TRS low pH (DAKO) for 20 min at 97°C (PT-Link ...
-
bioRxiv - Cancer Biology 2023Quote: ... The heat-induced antigen retrieval was performed with a microwave oven or a pressure cooker in a citrate buffer solution (Dako). Histochemical stainings were carried out using standard techniques for IHC and IHC-IF ...
-
bioRxiv - Developmental Biology 2022Quote: ... Sections were de-paraffinized using a graded alcohol series and antigen retrieval was carried out using target retrieval solution (Dako) at pH 6 or pH 9 in a pressure cooker ...
-
bioRxiv - Microbiology 2023Quote: ... Specific antigen-antibody reactions were visualized by means of 3,3’-diaminobenzidine tetrahydrochloride staining using the Dako Envision system (Dako Cytomation). Histopathological severity score of pneumonia was determined based on the percentage of alveolar inflammation in a given area of a pulmonary section collected from each animal in each group using the following scoring system ...
-
bioRxiv - Immunology 2023Quote: ... Heat-activated antigen retrieval was carried out on rehydrated tissue sections by incubating slides in prewarmed Agilent Dako pH6 antigen retrieval solution (catalog no. S2367; Agilent) for 20-minutes in a vegetable steamer (Black &Decker) ...
-
bioRxiv - Microbiology 2023Quote: ... were prepared and stained with hematoxylin eosin (HE) for histological examination or subjected to immunohistological staining to detect SARS-CoV-2 antigen (performed in an autostainer; Agilent), using the horseradish peroxidase (HRP ...
-
bioRxiv - Cell Biology 2023Quote: ... Comparator an d frozen shoulder capsular tissue sections were obtained through deparaffinization and target retrieval steps (high pH, heat-mediated antigen retrieval) using an automated PT Link (Dako). Antibody staining was performed using the EnVision FLEX visualization system with an Autostainer Link 48 (Dako) ...
-
bioRxiv - Cancer Biology 2023Quote: ... Antigen retrieval was first performed with high or low pH buffer depending on the primary antibody (CC1m, Roche or low pH antigen retrieval buffer, Dako), endogenous peroxidase was blocked (peroxide hydrogen at 3% ...
-
bioRxiv - Developmental Biology 2023Quote: For IHC staining slides were thawed and antigen-retrieval performed by incubating the sections with preheated Target Retrieval Solution (DAKO) 20 min at 70°C ...
-
bioRxiv - Cell Biology 2022Quote: ... Immediately after the slides were immersed in pre-heated (90-100 degree Celsius) 1X antigen retrieval solution (Dako, cat # S1699) for 25 min ...
-
bioRxiv - Cancer Biology 2023Quote: The 4-6um thick TMA sections were deparaffinized and antigens were unmasked using EnVision FLEX Target Retrival Solution Low pH (Dako Agilent) in PT link device (PT200 ...
-
bioRxiv - Neuroscience 2024Quote: ... Antigen retrieval treatment (95°C for 20 min) was added to expose masked epitopes with Target Retrieval Solution (Agilent Dako). After an hour blocking with 10% serum at RT ...
-
bioRxiv - Neuroscience 2024Quote: ... Antigen retrieval treatment (95°C for 20 min) was added to expose masked epitopes with Target Retrieval Solution (Agilent Dako). After an hour blocking with 10% serum at RT ...
-
bioRxiv - Biophysics 2021Quote: Aβ42 (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA) was expressed recombinantly in the Escherichia coli BL21 Gold (DE3) strain (Stratagene, CA, USA), and purified as described previously15 ...
-
bioRxiv - Molecular Biology 2019Quote: ... into XL1-red strains according to the manufacturer’s guidelines (XL1-Red Competent Cells, from Agilent Technologies). Yeast strains are listed in S2Table ...
-
bioRxiv - Microbiology 2021Quote: The Mtb strains adhered to the bottom of a XF cell culture microplate (Agilent technologies, USA), at 2X106 bacilli per well by using Cell-Tak (a cell adhesive) ...
-
bioRxiv - Biophysics 2020Quote: ... were prepared by expression in Escherichia coli BL21 (DE3) Gold Strain (Agilent Technologies, Santa Clara, USA)46 ...
-
bioRxiv - Neuroscience 2020Quote: ... All recombinant proteins were expressed in the BL21-Gold (DE3) pLysS strain of Escherichia coli (Agilent) in pGEX-KG vectors as glutathione S-transferase (GST ...
-
bioRxiv - Microbiology 2022Quote: ... Supernatants of each strain were speciated by high-performance liquid chromatography (HPCL) (Agilent Infinity II 1290) using a C18 column reverse- phase (130 Å ...
-
bioRxiv - Cell Biology 2023Quote: ... and the expression vector was introduced into an Escherichia coli strain BL21-CodonPlus (DE3)-RIL (Agilent). The transformed bacterial cells were grown at 37°C until OD600 reached 0.7 ...
-
bioRxiv - Cancer Biology 2021Quote: ... 4-µm sections were cut and antigen retrieval was carried out by heat treatment with Target Retrieval Solution (S1699, Agilent Technologies) for Ki67 ...
-
bioRxiv - Developmental Biology 2019Quote: ... Brain sections that were stained with antibodies that required antigen retrieval were incubated in Dako 1X target retrieval solution (Agilent Dako) or sodium acetate buffer ...
-
bioRxiv - Neuroscience 2020Quote: ... Heat antigen retrieval was performed by steaming at 98°C in target retrieval solution pH 6.1 (Dako, Carpinteira, CA, USA #S1699) for 30 minutes ...
-
bioRxiv - Cancer Biology 2022Quote: ... heat mediated antigen retrieval was performed for 3 min at 125°C in citrate pH 6.0 target retrieval solution (Dako Cat# S2369) using a decloaking chamber (Biocare Medical) ...
-
bioRxiv - Cancer Biology 2022Quote: Formalin-fixed samples tissue microarrays of EwS-samples and normal tissues were stained for GPR64 after antigen retrieval using Target Retrieval Solution (Fa.Agilent Technologies, S1699) with anti-GPR64 (purified using Mouse TCS Antibody Purification Kit (ab128749 ...
-
bioRxiv - Neuroscience 2021Quote: ... 3 μm paraffin-embedded tissue sections were either dewaxed and subjected to antigen retrieval treatment with Tris-EDTA buffer pH 9 for 20 min at 97°C using a PT Link (Dako – Agilent) or dewaxed as part of the antigen retrieval process using the Low pH EnVision ™ FLEX Target Retrieval Solutions (K8005 ...
-
bioRxiv - Neuroscience 2021Quote: ... or dewaxed as part of the antigen retrieval process using the Low pH EnVision ™ FLEX Target Retrieval Solutions (K8005, Dako-Agilent) for 20 min at 97°C using a PT Link (Dako – Agilent) ...
-
bioRxiv - Microbiology 2020Quote: ... ACE2 was detected using a rabbit polyclonal anti-hACE2 antibody (Cell Signalling, 4355S; citrate antigen-retrieval) and EnVision+ anti-rabbit HRP (Agilent, K4003). Slides were scanned with a bright field slide scanner (Leica ...