Labshake search
Citations for Agilent :
251 - 300 of 8935 citations for Mouse Macrophage expressed gene 1 protein MPEG1 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2020Quote: ... Different point mutations were introduced into SHANK3 constructs by site-directed mutagenesis (Gene Universal) or by using mutagenic oligonucleotides and the Quick-Change II site-directed mutagenesis kit (Agilent) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2021Quote: ... gambiae, a 15k-probe microarray (Agilent; A-MEXP-2196 [14], using the Agilent gene expression hybridization kit (Agilent Technologies, USA). Slides were washed according to the manufacturer’s instructions and scanned on an Agilent G2565CA microarray scanner ...
-
bioRxiv - Plant Biology 2019Quote: ... A 600 ng aliquot of labelled cRNA was used for fragmentation and array loading (Gene Expression Hybridisation Kit, Agilent Technologies). Hybridization ...
-
bioRxiv - Biochemistry 2021Quote: ... MYC-binding sites (E-boxes with the sequence CACGTG at positions -1149 bp and -1353 bp upstream of the transcription start site of the PTEN gene) were mutated to CAAGAA using Quikchange Lightening kit (Agilent). The TATA synthetic promoter sequence was derived from pGL firefly reporter with a minimal promoter.
-
Species-specific protein-protein interactions govern the humanization of the 20S proteasome in yeastbioRxiv - Genetics 2022Quote: The PSMB7 mutant gene library was previously generated (Kachroo et al, 2015) by error-prone PCR (GeneMorph II Random Mutagenesis Kit from Agilent) to introduce mutations and add attL1 and attL2 sites at the 5’ and 3’ ends of the gene (Reece-Hoyes & Walhout ...
-
bioRxiv - Microbiology 2022Quote: ... Mutations were made on pDUAL plasmids encoding the PR8 gene (64) using a QuikChange II site directed mutagenesis kit (Agilent) according to manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2023Quote: ... vector containing the SARS-CoV-2 HA-ORF3a gene was used in site-directed mutagenesis using a QuikChange II site-directed mutagenesis kit (Agilent) according to the manufacturer’s protocol ...
-
bioRxiv - Evolutionary Biology 2023Quote: ... An A to C mutation was made at base pair 219 within the CAT-I gene using the QuickChange Lightning Site-Directed Mutagenesis kit (Agilent) to match the native E ...
-
bioRxiv - Plant Biology 2024Quote: ... Fragmentation (at 60 °C) and hybridization (at 65° C for 16 hours) were done using the Gene Expression Hybridization kit of (Agilent Technologies ...
-
bioRxiv - Neuroscience 2024Quote: ... Point amino acid substitutions in genes encoding GluN subunits were performed using the QuikChange site-directed mutagenesis kit (Agilent Technologies) and verified by DNA sequencing.
-
bioRxiv - Neuroscience 2020Quote: ... followed by a mouse secondary antibody (rabbit polyclonal anti-mouse biotin antibody, E0413, Dako, 1:200). Histopathological studies of GBM xenograft mice were conducted by Division of Neuropathology ...
-
bioRxiv - Biophysics 2020Quote: The PEDV spike sample expressed in Sf9 cells was analyzed on Zorbax SB-C18 column (Agilent) with water with 0.1% formic acid and acetonitrile with 0.1% formic acid as mobile phases ...
-
bioRxiv - Biophysics 2021Quote: Aβ42 (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA) was expressed recombinantly in the Escherichia coli BL21 Gold (DE3) strain (Stratagene, CA, USA), and purified as described previously15 ...
-
bioRxiv - Neuroscience 2020Quote: GST-NT and GST-NT-ABmut were expressed in BL21-CodonPlus (DE3)-RIPL cells (Agilent, 230280), purified as described previously (Fujiwara et al. ...
-
Mechanical forces impair antigen discrimination by reducing differences in T cell receptor off-ratesbioRxiv - Immunology 2022Quote: ... TCR α and β chains were expressed in BL21 (DE3)-RIPL Escherichia coli cells (Agilent Technologies) following induction with 0.15 mM IPTG ...
-
bioRxiv - Biophysics 2023Quote: GST-His9-SARS-CoV2 RBDL Nucleocapsid construct was expressed recombinantly in Gold BL21(DE3) cells (Agilent). 4 L cultures were grown in LB medium with carbenicillin (100 ug/mL ...
-
bioRxiv - Cancer Biology 2020Quote: ... HRP-conjugated secondary antibodies used for detection were diluted 1:5000 (HRP-mouse anti rat, Cell Signaling Technology, Danvers, MA, Cat# CS7077S; HRP-mouse anti mouse, Dako, Agilent, Santa Clara ...
-
bioRxiv - Cancer Biology 2020Quote: ... HRP-conjugated secondary antibodies used for detection were diluted 1:5000 (HRP-mouse anti rat, Cell Signaling Technology, Danvers, MA, Cat# CS7077S; HRP-mouse anti mouse, Dako, Agilent ...
-
bioRxiv - Cancer Biology 2021Quote: ... mouse anti-CD44 (1:50, clone DF1485, Dako, M7082), rabbit anti-EGFR (prediluted ...
-
bioRxiv - Cell Biology 2020Quote: ... or goat anti-mouse IgG/HRP (1:5000, Dako) for 1 h at room temperature before being washed ...
-
bioRxiv - Cell Biology 2020Quote: ... horseradish peroxidase-conjugated anti-mouse (Dako, #P0447; 1:4,000) or anti-rabbit IgG (gamma-chain specific ...
-
bioRxiv - Genetics 2021Quote: ... and mouse-anti-Ki67 (Agilent, M7248, dilution 1:100). Goat-anti-mouse-488 and Goat-anti-rabbit-568 were used as secondary antibodies and sections were counterstained with DAPI ...
-
bioRxiv - Microbiology 2021Quote: ... then 1:1500 goat anti-mouse IgG-HRP (Dako); 1:1000 anti-HA (Roche) ...
-
bioRxiv - Microbiology 2021Quote: ... then 1:1500 goat anti-mouse IgG-HRP (Dako). Membranes were washed for 3 × 5 mins in TBST after each antibody step ...
-
bioRxiv - Cell Biology 2022Quote: ... or goat anti-mouse (DAKO, cat# P0447; 1:4,000).
-
bioRxiv - Neuroscience 2021Quote: ... Mouse anti-Ki67 (1:400, M724029-2, Agilent, UK) was used to label proliferative cells and rabbit anti-cleaved-Caspase3 (1:40 ...
-
bioRxiv - Molecular Biology 2021Quote: ... Horseradish Peroxidase conjuguated anti-mouse IgG (Dako, 1/5000) and anti-rabbit IgG (Dako ...
-
bioRxiv - Cell Biology 2019Quote: ... or goat anti mouse-HRP (1:100, P0447, DAKO) (type II collagen ...
-
bioRxiv - Developmental Biology 2019Quote: ... or mouse anti-human CD31 (Dako, M0823, 1:50) overnight at 4°C and then goat anti-mouse Alexa488 (ThermoFisher Scientific ...
-
bioRxiv - Neuroscience 2020Quote: ... mouse clone CR3/43 (1:20, Agilent, M077501–2). Sections were incubated for 1 hour at room temperature with secondary antibodies (1:1000) ...
-
bioRxiv - Molecular Biology 2021Quote: ... and mouse anti-HIV p24 (Kal-1 clone, Dako). DAB staining was performed using a Ventana Ultraview DAB detection kit in a Ventana BenchMark XT processor (Ventana Medical Systems ...
-
bioRxiv - Neuroscience 2020Quote: ... monoclonal mouse anti-AE1/AE3 (DAKO M3515, 1:200), monoclonal mouse anti-MRP14 (Acris ...
-
bioRxiv - Cell Biology 2021Quote: ... Mouse anti-Vimentin (1:100; M0725, Dako, Baar, Switzerland), Mouse anti-FRZB (1:50 ...
-
bioRxiv - Developmental Biology 2022Quote: ... Mouse anti-iodinated thyroglobulin polyclonal antibody (1:1000; Dako), cy3-conjugated donkey anti-goat IgG antibody (1:250 ...
-
bioRxiv - Cancer Biology 2022Quote: ... and mouse anti-PSMA antibody (Dako, M3620, 1:50). Slides were washed with TBST and incubated with PowerVision Poly-HRP anti-rabbit IgG or anti-mouse IgG (Leica Biosystems ...
-
bioRxiv - Cancer Biology 2022Quote: ... rabbit anti-mouse HRP (1:2500, DAKO, P0448, P0260) or donkey anti-goat HRP (1:2500 ...
-
bioRxiv - Cell Biology 2021Quote: ... anti-rabbit or anti-mouse immunoglobulins (1:3000, Dako), were applied for 1 h at room temperature and detected using SuperSignal chemiluminescent substrates (Pierce).
-
Werner syndrome helicase is a selective vulnerability of microsatellite instability high tumor cellsbioRxiv - Cancer Biology 2019Quote: ... mouse anti-IgG-HRP(Dako P0161, 1/1000 dilution) and mouse Alexa Fluor 488 (Molecular Probes ...
-
bioRxiv - Cell Biology 2019Quote: ... desmin (clone D33, mouse monoclonal IgG1, Dako, 1:400); β-actin (rabbit polyclonal IgG ...
-
bioRxiv - Biochemistry 2020Quote: ... mouse anti-IgG-HRP (Dako, P0161, 1/1000 dilution)
-
bioRxiv - Microbiology 2022Quote: ... anti-CD20 (mouse monoclonal [Clone L26]; Agilent; 1:200); anti-VGLUT1 (rabbit polyclonal ...
-
bioRxiv - Physiology 2023Quote: ... CD68 (mouse monoclonal, 1:100, M0814 KP1 clone, Dako), GFAP (mouse monoclonal ...
-
bioRxiv - Neuroscience 2023Quote: ... mouse monoclonal anti-PCNA (1:300; M087901-2 Agilent); guinea pig polyclonal anti-Doublecortin (DCX ...
-
bioRxiv - Cell Biology 2023Quote: ... rabbit anti-mouse IgG/HRP (Dako, P0161, 1:5000).
-
bioRxiv - Biochemistry 2023Quote: ... 2nd Ab: anti-mouse (Agilent Dako, P0447, 1:1500).
-
bioRxiv - Molecular Biology 2023Quote: ... and revealed with anti-mouse (Dako P0447, 1/5000) or anti-rabbit (Jackson Immuno Research 111-035-003 ...
-
bioRxiv - Biochemistry 2023Quote: ... 2nd Ab: anti-mouse (Agilent Dako, P0447, 1:1500).
-
bioRxiv - Genomics 2021Quote: The genes up-regulated or down-regulated significantly were categorized by panther process name of the gene prepared by Agilent data for human microarray.
-
bioRxiv - Developmental Biology 2023Quote: Whole-mount immunostaining of differentiated skeletal muscle cells was performed using the monoclonal hybridoma 12/101 primary antibody [38] (1/200 dilution; DSHB #AB-531892) and the EnVision+ Mouse HRP kit (Agilent Technologies, K4007) according to the manufacturer’s recommendations.
-
bioRxiv - Plant Biology 2020Quote: ... Probes covering resistance genes were collected from Agilent catalog (AMADID 037661 ...