Labshake search
Citations for Agilent :
101 - 150 of 737 citations for Zika Virus NS1 Proteins Uganda Suriname Strains Duo Pack since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2024Quote: ... virus was UV-inactivated using a UV STRATAlinker 2400 box (Stratagene, San, Diego, CA). To block viral late gene expression ...
-
bioRxiv - Cancer Biology 2021Quote: ... staining was revealed using the IDetect Super strain HRP polymer kit (Agilent) following manufacturer’s protocol ...
-
bioRxiv - Plant Biology 2020Quote: ... The plasmids were transformed into Escherichia coli strain BL21 (DE3) RIL (Stratagene). Expression was induced at 16 °C overnight with 0.2 mM of IPTG ...
-
bioRxiv - Microbiology 2019Quote: ... coli strain BL21-CodonPlus (DE3)-RIL (Agilent Technologies, Santa Clara, CA, USA), and purified using HisTrap HP (GE Healthcare).
-
bioRxiv - Plant Biology 2019Quote: ... which was transformed into E.coli strain BL21 RIL (Agilent Technologies; Waldbronn, Germany) to be expressed as C-terminally 6xHis-tagged recombinant protein ...
-
bioRxiv - Biochemistry 2022Quote: ... the cloning host Escherichia coli XL1-Blue strain was from Stratagene (USA), and the plasmid pRSETC and E ...
-
bioRxiv - Biophysics 2023Quote: ... Cell transfection and virus production was performed using the MBS Mammalian Transfection Kit (Agilent Technologies). The infectious supernatant was collected 72 hours after transfection and filtered onto CHO-K1 target cells for transduction ...
-
bioRxiv - Neuroscience 2023Quote: Adeno-associated virus (AAV) vector was prepared using the AAV Helper-Free system (Agilent Technologies) as described previously (Kato et al. ...
-
bioRxiv - Cell Biology 2023Quote: ... The virus was expanded by one round of infection of Ad-293 cells (Agilent 240085) at 5 plaque forming units (PFU ...
-
bioRxiv - Microbiology 2021Quote: The pET-28a+ expression construct was transferred into BL21(DE3)/pLys strain (Stratagene) and protein production was induced at 37°C with 1 mM IPTG (isopropyl-β-D-thiogalactopyranoside ...
-
bioRxiv - Bioengineering 2022Quote: ... The Escherichia coli strains DH5α and BL21-Gold (DE3) were purchased from Agilent Technologies (Santa Clara ...
-
bioRxiv - Bioengineering 2020Quote: ... coli strains from glycerol were further analyzed through HPLC (1100 Series HPLC; Agilent) connected with MS (LC/MSD VL ...
-
bioRxiv - Genomics 2019Quote: ... The plasmid was transformed and expanded in XL10-Gold Escherichia coli strain (Stratagene). The cDNA of the plasmid was sent for Sanger sequencing to validate the gene sequence.
-
bioRxiv - Biochemistry 2019Quote: XL-1 and BL21(DE3)pLysS strains of E.coli were purchased from Stratagene (USA) and a previously described vector pGEMEX-1(his6 ...
-
bioRxiv - Molecular Biology 2020Quote: ... The plasmid was transformed into Escherichia coli strain BL21-Codon-plus(DE3)-RIL (Stratagene). Bacteria was grown in LB broth in a shaker at 37°C until reaching the log phase (A600nm between 0.4 and 0.5) ...
-
bioRxiv - Cell Biology 2022Quote: ... GST-TNY constructs were transformed into E.coli BL21 codon plus-RIL strain (Agilent Technologies). Cells were grown in LB media and induced for 5 hrs at 30°C with 0.5 mM isopropyl-β-d-thiogalactopyranoside (IPTG ...
-
bioRxiv - Cell Biology 2022Quote: ... The construct was transformed into E.coli strain BL21 codon plus-RIL (DE3) (Agilent technologies). Induction of recombinant TNY1 expression in E ...
-
bioRxiv - Biophysics 2023Quote: ... These histones were co-expressed in Escherichia coli strain BL21-codonplus-DE3-RIL (Agilent), and the histone octamer with the K120>C mutation in histone H2A was purified according to Ref33 ...
-
bioRxiv - Biophysics 2023Quote: ... Aβ42 was expressed in the Escherichia coli BL21Gold (DE3) strain (Stratagene, La Jolla, CA) and purified by sonication and dissolving the inclusion bodies in 8 M urea ...
-
bioRxiv - Molecular Biology 2024Quote: ... The expression plasmids were transformed into Escherichia Coli strain BL21-Codonplus(DE3)-RIL (Stratagene). The expression and purification of each protein was performed as described previously.77 Briefly ...
-
bioRxiv - Immunology 2021Quote: ... and Protein block (Protein block (Dako) according to manufacturer’s protocol ...
-
bioRxiv - Molecular Biology 2022Quote: Recombinant production/purification: The MLucV construct was expressed in BL21-CodonPlus (DE3)-RIPL strain (Agilent) using ampicillin and chloramphenicol as the selection antibiotic ...
-
bioRxiv - Molecular Biology 2022Quote: ... 2 ng DNA was transformed into the Validation Reporter (VR) strain (Agilent Technologies #200192; discontinued) to obtain 30-40 million transformants using electroporation ...
-
bioRxiv - Biophysics 2022Quote: ... Aβ40/Aβ42 was expressed in the Escherichia coli BL21Gold (DE3) strain (Stratagene, La Jolla, CA) and purified by sonication and dissolving the inclusion bodies in 8 M urea ...
-
bioRxiv - Neuroscience 2022Quote: ... The insert was verified by sequencing and then transformed into BL21 Escherichia coli strain (Stratagene) for expression ...
-
bioRxiv - Microbiology 2021Quote: The CPB mutant virus was generated using a two part QuikChange site-directed mutagenesis (Agilent, Santa Clara, CA) of the TE12 SINV cDNA clone ...
-
bioRxiv - Immunology 2022Quote: ... values at the endpoint (36 hours after virus inoculation) were determined using the RTCA software version 2.1.0 (Agilent). Percent neutralization was calculated as the CI in the presence of mAb divided by the cells only (no-CPE control ...
-
bioRxiv - Biophysics 2021Quote: Aβ42 (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA) was expressed recombinantly in the Escherichia coli BL21 Gold (DE3) strain (Stratagene, CA, USA), and purified as described previously15 ...
-
bioRxiv - Molecular Biology 2019Quote: ... into XL1-red strains according to the manufacturer’s guidelines (XL1-Red Competent Cells, from Agilent Technologies). Yeast strains are listed in S2Table ...
-
bioRxiv - Microbiology 2021Quote: The Mtb strains adhered to the bottom of a XF cell culture microplate (Agilent technologies, USA), at 2X106 bacilli per well by using Cell-Tak (a cell adhesive) ...
-
bioRxiv - Biophysics 2020Quote: ... were prepared by expression in Escherichia coli BL21 (DE3) Gold Strain (Agilent Technologies, Santa Clara, USA)46 ...
-
bioRxiv - Microbiology 2022Quote: ... Supernatants of each strain were speciated by high-performance liquid chromatography (HPCL) (Agilent Infinity II 1290) using a C18 column reverse- phase (130 Å ...
-
bioRxiv - Cell Biology 2023Quote: ... and the expression vector was introduced into an Escherichia coli strain BL21-CodonPlus (DE3)-RIL (Agilent). The transformed bacterial cells were grown at 37°C until OD600 reached 0.7 ...
-
bioRxiv - Immunology 2022Quote: ... 50 μL virus/antibody mixture and controls were added to HuH-7.5 cell culture monolayers in 96-well ePlates (Agilent) and incubated for 1 hr at 37°C ...
-
bioRxiv - Animal Behavior and Cognition 2023Quote: ... Each annealed oligonucleotide was ligated into the adeno-associated virus (AAV2) plasmid (pAAV-EGFP-shRNA; Stratagene, La Jolla, CA)(Hommel et al. ...
-
bioRxiv - Biophysics 2023Quote: Rec and RecC39D were produced in Escherichia coli strain BL21-CodonPlus®(DE3)-RIL-X (Agilent, USA) co-transformed with a pBB131 plasmid ...
-
bioRxiv - Neuroscience 2022Quote: ... Protein blocking was performed using protein block solution (DAKO) for 30 minutes at room temperature ...
-
bioRxiv - Microbiology 2021Quote: ... UV-inactivation was carried by irradiation of virus-containing supernatant in a 15cm plate prior the concentration step in Stratalinker 1800 (Stratagene) at the standard power for 3 times 3min with swirling of the plate between each round ...
-
bioRxiv - Neuroscience 2023Quote: ... woodchuck hepatitis virus posttranscriptional regulatory element (WPRE) and SV40 polyadenylation signal was assembled using a modified helper-free system (Stratagene) as a serotype 2/1 (rep/cap genes ...
-
bioRxiv - Bioengineering 2023Quote: ... protein block with Dako protein block solution (Dako, Glostrup, Denmark), incubation with primary antibodies [eGFP (Abcam ...
-
bioRxiv - Microbiology 2021Quote: The oxygen consumption rates (OCR) of Mtb strains were measured using a Seahorse XF96e Extracellular Flux Analyzer (Agilent). Mtb bacilli were adhered to the bottom of a Cell-Tak-coated XF cell culture microplate at 2×106 bacilli per well ...
-
bioRxiv - Cancer Biology 2022Quote: ... pGEX-RBD (a gift from G. Bokoch) was transformed into BL21(DE3)-competent strain of bacteria (Agilent Technologies) and propagated in a shaker incubator at 225 rpm and 37°C until an optical density of 0.9 at 600 nm was reached ...
-
bioRxiv - Microbiology 2024Quote: Growth curves for H53 wild type and ΔcirA strains were measured using BioTek Epoch 2 microplate reader with BioTek Gen6 v.1.03.01 (Agilent). Colonies of each strain were inoculated in 5 mL Hv-Cab liquid medium and grown shaking at 45°C until an OD600 0.15 was reached ...
-
bioRxiv - Immunology 2020Quote: ... by placing the virus for 2 minutes in a UV Stratalinker 2400 equipped with 365 nm long-wave UV bulbs (Stratagene, USA). UV-inactivation was confirmed by lack of cytopathic effect on BSC-1 cells infected with i-VACV for up to 3 days (data not shown).
-
bioRxiv - Cancer Biology 2019Quote: ... protein block (Dako) for 10 minutes at room temperature ...
-
bioRxiv - Immunology 2021Quote: ... Protein Block (Agilent) was used to block nonspecific antibody binding before incubating the sections with primary antibody overnight at 4°C ...
-
bioRxiv - Neuroscience 2020Quote: ... DNA fragments encoding the ACR-16 TM3-4 loop or the SDN-1 intracellular domain full length or lacking the EYFA PDZ binding motif were cloned to pGEX-3X expression vector and then transfected into Arctic express E.coli strain (Agilent). Bacterial clones were first cultured overnight in 5 mL LB medium supplemented with 100 mg/mL ampicillin ...
-
bioRxiv - Genetics 2020Quote: The transgenic strain harboring icIs270 was generated by exposing L4 hermaphrodites to UV-TMP (350microJoules x 100 on Stratagene UV Stratalinker ...
-
bioRxiv - Neuroscience 2023Quote: ... These pUAST-(G4C2)n vectors were amplified with a recombinase-mutated SURE®2 Escherichia coli strain (Agilent Technologies) at 28 °C for 72 hours to prevent repeat length contraction ...
-
bioRxiv - Genetics 2023Quote: His6-SUMO-RhinoCD constructs (spanning Rhino residues 20-90 in the vector pET-28) were transformed into the E.coli strain BL21-CodonPlus (DE3)-RIPL (Agilent) for large-scale expression using standard methods ...