Labshake search
Citations for Atlas Antibodies AB :
51 - 100 of 367 citations for Slow Skeletal Troponin C TNNC1 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2022Quote: ... Antibodies used were anti-RBPMS (Atlas antibodies HPA056999, 1:1000 dil), anti-RBFOX2 (Atlas antibodies HPA006240 – 1:500 dil) ...
-
bioRxiv - Cell Biology 2023Quote: ... the slides were incubated with α-LTβ antibody (Atlas Antibodies, HPA048884) at a 1:100 dilution for 1 hour at room temperature ...
-
bioRxiv - Molecular Biology 2023Quote: ... GLDC protein abundance was determined using anti-GLDC antibody (Atlas antibodies), with GAPDH (detected using anti-GAPDH ...
-
bioRxiv - Microbiology 2024Quote: ... and immunostained with our anti-EBOV VP35 mouse antibody and an anti-STRAP rabbit antibody (Atlas Antibodies, Bromma, Sweden) at 1:3000 and 1:1000 respectively for several hours at 37°C ...
-
bioRxiv - Cancer Biology 2022Quote: ... the cells were probed with primary antibodies against ALKBH5 (HPA007196, Atlas Antibodies) and then incubated with a Goat anti-Rabbit IgG (H + L ...
-
bioRxiv - Cell Biology 2021Quote: The following antibodies were used in this study: RASSF1A (HPA040735, Atlas Antibodies), RASSF1A (3F3 ...
-
bioRxiv - Cancer Biology 2020Quote: ... and incubated in the anti-ORMDL1 antibody (1:100, PHA065643, Atlas Antibodies) overnight at 4℃ ...
-
bioRxiv - Cancer Biology 2020Quote: ... After being incubated with anti-ORMDL1 antibody (1:100, PHA065643, Atlas Antibodies) and following secondary antibody according to product manual ...
-
bioRxiv - Neuroscience 2022Quote: ... Primary antibodies used were the following: DDX5 (Atlas Antibodies, HPA020043, [1:200]) and NeuN (Millipore ...
-
bioRxiv - Cell Biology 2019Quote: ... made by Prestige Antibodies Powered by Atlas Antibodies (Sigma-Aldrich, catalog #: HPA017430). The amino acid sequence of the antigen is MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGS KEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.
-
bioRxiv - Biophysics 2021Quote: ... Binding of primary antibody (Elys (catalog no. HPA031658, Atlas Antibodies, 1:50), Nup133 (catalog no ...
-
bioRxiv - Cell Biology 2023Quote: ... or in 4% fetal bovine serum for antibodies acquired from ATLAS antibodies for at least 40 minuntes at RT ...
-
bioRxiv - Cell Biology 2023Quote: ... Primary antibodies used included SNX17 rabbit pAb (1:1000, HPA043867, Atlas Antibodies), SNX17 mouse mAb ...
-
bioRxiv - Cell Biology 2023Quote: ... Antibodies against GOLGA1_1 Golgin-97 (cat: HPA044329) were purchased from Atlas Antibodies. Antibodies against LMAN1 ERGIC-53 (cat ...
-
bioRxiv - Cell Biology 2023Quote: ... the membrane was incubated overnight with anti-MRPP1 antibody (Atlas Antibodies, HPA036671) at 1:1000 dilution or anti-GAPDH antibody (Novus Biologicals ...
-
bioRxiv - Molecular Biology 2021Quote: ... ZC3H4 (HPA040934, Atlas Antibodies), HA tag (clone 3f10 ...
-
bioRxiv - Developmental Biology 2019Quote: ... KLF17 (Atlas Antibodies HPA024629), TFCP2L1 (R&D Systems AF5726) ...
-
bioRxiv - Cell Biology 2019Quote: ... MIC27 (Atlas Antibodies, HPA000612), MIC60 (custom-made ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and Tubulin (T6199 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies), PABPN1 (LS-B8482 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and specific myosin heavy chain isotype were stained with MyHC-2a and MyHC-2b conjugated to 594 and 488 fluorophore ...
-
bioRxiv - Immunology 2019Quote: ... and FATP3 (Atlas antibodies) were measured in conjunction with goat anti-rabbit AF488 (Abcam) ...
-
bioRxiv - Cancer Biology 2021Quote: ... NAGK (Atlas Antibodies, HPA035207), and PARP (Cell Signaling 9532).
-
bioRxiv - Cell Biology 2021Quote: ... Treacle (HPA038237, Atlas Antibodies), NBS1 (1D7 ...
-
bioRxiv - Microbiology 2020Quote: ... PAPD5 (Atlas Antibodies, HPA042968) at 1:1000 and ZCCHC14 (Bethyl ...
-
bioRxiv - Cancer Biology 2021Quote: ... HMCES (HPA044968, Atlas Antibodies). The HMCES knockdown stable cell lines (HCC-78 ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670). Alexa Fluor®-488 and Alexa Fluor®-555 (Cell Signaling) ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670), Calnexin (Abcam ...
-
bioRxiv - Cancer Biology 2020Quote: ... NAGK (Atlas Antibodies HPA035207), O-GlcNAc (Abcam 2735) ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-WASH1 (Atlas Antibodies, cat ...
-
bioRxiv - Biochemistry 2021Quote: ... ITIH4 (Atlas Antibodies, HPA003948), MFGE8 (Thermo Scientific ...
-
bioRxiv - Biochemistry 2021Quote: ... CLPTM1L (HPA014791, Atlas Antibodies), UBE2J1 (sc-377002 ...
-
bioRxiv - Cell Biology 2020Quote: ... NPHP4 (Atlas Antibodies, #HPA065526), GFP (Aves Labs Inc ...
-
bioRxiv - Cell Biology 2023Quote: ... MIC19 (Atlas Antibodies, HPA042935), COX3 (Proteintech ...
-
bioRxiv - Molecular Biology 2023Quote: ... GPD1 (HPA044620, Atlas Antibodies).
-
bioRxiv - Molecular Biology 2023Quote: ... BCAP31 (Atlas Antibodies, HPA003906) and V5-epitope (SAB1306079 ...
-
bioRxiv - Cancer Biology 2023Quote: ... RUVBL1 (Atlas Antibodies, # HPA019947), HSPD1 (Atlas Antibody ...
-
bioRxiv - Cancer Biology 2023Quote: ... COX4I1 (Atlas antibody, #HPA002485), KRT19 (Abcam ...
-
bioRxiv - Cancer Biology 2023Quote: ... MYH10 (Atlas Antibodies, #HPA047541), cytochalasin D (Thermo Fisher ...
-
bioRxiv - Cancer Biology 2023Quote: ... HSPA9 (Atlas Antibody, #HPA000898), COX4I1 (Atlas antibody ...
-
bioRxiv - Cancer Biology 2023Quote: ... RUVBL2 (Atlas Antibodies, #HPA067966), RUVBL1 (Atlas Antibodies ...
-
bioRxiv - Cancer Biology 2023Quote: ... HSPD1 (Atlas Antibody, #HPA050025), HSPA9 (Atlas Antibody ...
-
bioRxiv - Genetics 2023Quote: ... MITF (HPA003259, Atlas Antibodies) 1:100 and tubulin-AF488 (clone DM1A ...
-
bioRxiv - Immunology 2023Quote: ... KLC2 (Atlas Antibodies, HPA040416), CNOT1 (Cell Signaling Technology ...
-
bioRxiv - Cell Biology 2023Quote: ... CEP120 (Atlas Antibodies; HPA028823): 1/500 ...
-
bioRxiv - Neuroscience 2023Quote: ... EMX1 (Atlas Antibodies, HPA006421); LHX9 (Sigma ...
-
bioRxiv - Molecular Biology 2024Quote: ... Anti- NUDT16L1 (Atlas Antibodies) 1:500 ...
-
bioRxiv - Molecular Biology 2023Quote: ... ALKBH5 (Atlas Antibodies, HPA007196), ZFC3H1 (Bethyl laboratories ...
-
bioRxiv - Molecular Biology 2020Quote: ... Rabbit polyclonal antibodies (PABPC1, Atlas Antibodies #HPA045423; p70 S6 kinase α (H-160), Santa Cruz #sc-9027 ...
-
bioRxiv - Cell Biology 2020Quote: ... rabbit anti-PLCE1 antibody diluted at 1:1000 (HPA015597, Atlas Antibodies, Bromma, Sweden); peroxidase-conjugated mouse anti-β-actin antibody diluted at 1:10,000 (clone 2F3 ...