Labshake search
Citations for Atlas Antibodies AB :
251 - 300 of 367 citations for Rabbit Anti Borrelia burgdorferi sensu stricto B31 P35 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2022Quote: ... Primary antibodies used were the following: DDX5 (Atlas Antibodies, HPA020043, [1:200]) and NeuN (Millipore ...
-
bioRxiv - Cell Biology 2019Quote: ... made by Prestige Antibodies Powered by Atlas Antibodies (Sigma-Aldrich, catalog #: HPA017430). The amino acid sequence of the antigen is MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGS KEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.
-
bioRxiv - Biophysics 2021Quote: ... Binding of primary antibody (Elys (catalog no. HPA031658, Atlas Antibodies, 1:50), Nup133 (catalog no ...
-
bioRxiv - Cell Biology 2023Quote: ... or in 4% fetal bovine serum for antibodies acquired from ATLAS antibodies for at least 40 minuntes at RT ...
-
bioRxiv - Cell Biology 2023Quote: ... Antibodies against GOLGA1_1 Golgin-97 (cat: HPA044329) were purchased from Atlas Antibodies. Antibodies against LMAN1 ERGIC-53 (cat ...
-
bioRxiv - Molecular Biology 2021Quote: ... ZC3H4 (HPA040934, Atlas Antibodies), HA tag (clone 3f10 ...
-
bioRxiv - Developmental Biology 2019Quote: ... KLF17 (Atlas Antibodies HPA024629), TFCP2L1 (R&D Systems AF5726) ...
-
bioRxiv - Cell Biology 2019Quote: ... MIC27 (Atlas Antibodies, HPA000612), MIC60 (custom-made ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and Tubulin (T6199 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies), PABPN1 (LS-B8482 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and specific myosin heavy chain isotype were stained with MyHC-2a and MyHC-2b conjugated to 594 and 488 fluorophore ...
-
bioRxiv - Immunology 2019Quote: ... and FATP3 (Atlas antibodies) were measured in conjunction with goat anti-rabbit AF488 (Abcam) ...
-
bioRxiv - Cancer Biology 2021Quote: ... NAGK (Atlas Antibodies, HPA035207), and PARP (Cell Signaling 9532).
-
bioRxiv - Cell Biology 2021Quote: ... Treacle (HPA038237, Atlas Antibodies), NBS1 (1D7 ...
-
bioRxiv - Microbiology 2020Quote: ... PAPD5 (Atlas Antibodies, HPA042968) at 1:1000 and ZCCHC14 (Bethyl ...
-
bioRxiv - Cancer Biology 2021Quote: ... HMCES (HPA044968, Atlas Antibodies). The HMCES knockdown stable cell lines (HCC-78 ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670). Alexa Fluor®-488 and Alexa Fluor®-555 (Cell Signaling) ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670), Calnexin (Abcam ...
-
bioRxiv - Cancer Biology 2020Quote: ... NAGK (Atlas Antibodies HPA035207), O-GlcNAc (Abcam 2735) ...
-
bioRxiv - Biochemistry 2021Quote: ... ITIH4 (Atlas Antibodies, HPA003948), MFGE8 (Thermo Scientific ...
-
bioRxiv - Biochemistry 2021Quote: ... CLPTM1L (HPA014791, Atlas Antibodies), UBE2J1 (sc-377002 ...
-
bioRxiv - Cell Biology 2020Quote: ... NPHP4 (Atlas Antibodies, #HPA065526), GFP (Aves Labs Inc ...
-
bioRxiv - Molecular Biology 2023Quote: ... GPD1 (HPA044620, Atlas Antibodies).
-
bioRxiv - Cell Biology 2023Quote: ... MIC19 (Atlas Antibodies, HPA042935), COX3 (Proteintech ...
-
bioRxiv - Molecular Biology 2023Quote: ... BCAP31 (Atlas Antibodies, HPA003906) and V5-epitope (SAB1306079 ...
-
bioRxiv - Cancer Biology 2023Quote: ... RUVBL1 (Atlas Antibodies, # HPA019947), HSPD1 (Atlas Antibody ...
-
bioRxiv - Cancer Biology 2023Quote: ... COX4I1 (Atlas antibody, #HPA002485), KRT19 (Abcam ...
-
bioRxiv - Cancer Biology 2023Quote: ... MYH10 (Atlas Antibodies, #HPA047541), cytochalasin D (Thermo Fisher ...
-
bioRxiv - Cancer Biology 2023Quote: ... HSPA9 (Atlas Antibody, #HPA000898), COX4I1 (Atlas antibody ...
-
bioRxiv - Cancer Biology 2023Quote: ... RUVBL2 (Atlas Antibodies, #HPA067966), RUVBL1 (Atlas Antibodies ...
-
bioRxiv - Cancer Biology 2023Quote: ... HSPD1 (Atlas Antibody, #HPA050025), HSPA9 (Atlas Antibody ...
-
bioRxiv - Genetics 2023Quote: ... MITF (HPA003259, Atlas Antibodies) 1:100 and tubulin-AF488 (clone DM1A ...
-
bioRxiv - Neuroscience 2023Quote: ... EMX1 (Atlas Antibodies, HPA006421); LHX9 (Sigma ...
-
bioRxiv - Cell Biology 2023Quote: ... CEP120 (Atlas Antibodies; HPA028823): 1/500 ...
-
bioRxiv - Immunology 2023Quote: ... KLC2 (Atlas Antibodies, HPA040416), CNOT1 (Cell Signaling Technology ...
-
bioRxiv - Molecular Biology 2023Quote: ... ALKBH5 (Atlas Antibodies, HPA007196), ZFC3H1 (Bethyl laboratories ...
-
bioRxiv - Cell Biology 2021Quote: ... The PVDF membrane was blocked and then incubated with KCNQ1 antibodies (ATLAS ANTIBODIES) overnight at 4°C ...
-
bioRxiv - Neuroscience 2022Quote: ... followed by overnight incubation with primary antibodies (CDKL5- 1:1000, #HPA002847, Atlas Antibodies-Sigma Aldrich ...
-
bioRxiv - Microbiology 2021Quote: ... For the microscopy we used the following antibodies: PAF1 1:500 (Atlas antibodies, HPA043637), Strep 1:1000 (Qiagen ...
-
bioRxiv - Molecular Biology 2021Quote: ... or ZC3H4 (HPA040934, Atlas Antibodies) were used for immunoprecipitation ...
-
bioRxiv - Cell Biology 2020Quote: ... (Atlas Antibodies, Cat# HPA028075, RRID:AB_10603778), MAP7D3 (Atlas Antibodies ...
-
bioRxiv - Cell Biology 2019Quote: ... Sept9 (SIGMA Atlas Antibodies HPA042564), Sept11 (kind gift from Bill Trimble) ...
-
bioRxiv - Cell Biology 2019Quote: Sept2 (SIGMA Atlas Antibodies HPA018481), Sept7 (IBL JP18991) ...
-
bioRxiv - Cell Biology 2019Quote: ... Sept9 (SIGMA Atlas Antibodies HPA042564), Sept11 (Millipore ABN1342) ...
-
bioRxiv - Cell Biology 2020Quote: ... (Atlas Antibodies AB, Bromma, Sweden) and monoclonal mouse IgG antibody MAB933 ...
-
bioRxiv - Cell Biology 2022Quote: ... CYB5B (HPA007893, Atlas antibodies, USA); MIRO2 (RHOT2 ...
-
bioRxiv - Cell Biology 2023Quote: ... 1:300 (Atlas Antibodies, HPA012145), chicken anti-GFP ...
-
bioRxiv - Neuroscience 2023Quote: ... and FOXP2 (HPA000382, Atlas Antibodies), which is expressed in layer VI neurons ...
-
bioRxiv - Cancer Biology 2023Quote: ... FOXJ1 (Atlas antibodies, Cat# HPA005714) at 1:700 ...
-
bioRxiv - Biochemistry 2023Quote: ... RBM39 (no. HPA001591, Atlas Antibodies), RBX1 (D3J5I ...