Labshake search

251 - 300 of 367 citations for Rabbit Anti Borrelia burgdorferi sensu stricto B31 OspB Antibody since 2019

• Identification of protein aggregates in the aging vertebrate brain with prion-like and phase separation properties

  Itamar Harel, et al., bioRxiv - Neuroscience 2022

  Quote: ... Primary antibodies used were the following: DDX5 (Atlas Antibodies, HPA020043, [1:200]) and NeuN (Millipore ...
• Actin chromobody imaging reveals sub-organellar actin dynamics

  Cara R. Schiavon, et al., bioRxiv - Cell Biology 2019

  Quote: ... made by Prestige Antibodies Powered by Atlas Antibodies (Sigma-Aldrich, catalog #: HPA017430). The amino acid sequence of the antigen is MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGS KEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.
• Maximum-likelihood model fitting for quantitative analysis of SMLM data

  Yu-Le Wu, et al., bioRxiv - Biophysics 2021

  Quote: ... Binding of primary antibody (Elys (catalog no. HPA031658, Atlas Antibodies, 1:50), Nup133 (catalog no ...
• Notch1 forms nuclear transcriptional condensates that drive target gene expression

  Gregory Foran, et al., bioRxiv - Cell Biology 2023

  Quote: ... or in 4% fetal bovine serum for antibodies acquired from ATLAS antibodies for at least 40 minuntes at RT ...
• Unraveling cellular complexity with unlimited multiplexed super-resolution imaging

  Florian Schueder, et al., bioRxiv - Cell Biology 2023

  Quote: ... Antibodies against GOLGA1_1 Golgin-97 (cat: HPA044329) were purchased from Atlas Antibodies. Antibodies against LMAN1 ERGIC-53 (cat ...
• ZC3H4 restricts non-coding transcription in human cells

  Chris Estell, et al., bioRxiv - Molecular Biology 2021

  Quote: ... ZC3H4 (HPA040934, Atlas Antibodies), HA tag (clone 3f10 ...
• Efficient RNA-mediated reprogramming of human somatic cells to naïve pluripotency facilitated by tankyrase inhibition

  Nicholas Bredenkamp, et al., bioRxiv - Developmental Biology 2019

  Quote: ... KLF17 (Atlas Antibodies HPA024629), TFCP2L1 (R&D Systems AF5726) ...
• Cristae undergo continuous cycles of fusion and fission in a MICOS-dependent manner

  Arun Kumar Kondadi, et al., bioRxiv - Cell Biology 2019

  Quote: ... MIC27 (Atlas Antibodies, HPA000612), MIC60 (custom-made ...
• Reduced PABPN1 levels causes cytoskeleton disorganization and aberrant differentiation

  Cyriel Sebastiaan Olie, et al., bioRxiv - Cell Biology 2020

  Quote: ... MURC (HPA021021, Atlas antibodies) and Tubulin (T6199 ...
• Reduced PABPN1 levels causes cytoskeleton disorganization and aberrant differentiation

  Cyriel Sebastiaan Olie, et al., bioRxiv - Cell Biology 2020

  Quote: ... MURC (HPA021021, Atlas antibodies), PABPN1 (LS-B8482 ...
• Reduced PABPN1 levels causes cytoskeleton disorganization and aberrant differentiation

  Cyriel Sebastiaan Olie, et al., bioRxiv - Cell Biology 2020

  Quote: ... MURC (HPA021021, Atlas antibodies) and specific myosin heavy chain isotype were stained with MyHC-2a and MyHC-2b conjugated to 594 and 488 fluorophore ...
• Mitochondrial mass governs the extent of T cell senescence

  Lauren A. Callender, et al., bioRxiv - Immunology 2019

  Quote: ... and FATP3 (Atlas antibodies) were measured in conjunction with goat anti-rabbit AF488 (Abcam) ...
• Glutamine deprivation triggers NAGK-dependent hexosamine salvage

  Sydney L. Campbell, et al., bioRxiv - Cancer Biology 2021

  Quote: ... NAGK (Atlas Antibodies, HPA035207), and PARP (Cell Signaling 9532).
• 53BP1 mediated recruitment of RASSF1A at ribosomal DNA breaks facilitates local ATM signal amplification

  Stavroula Tsaridou, et al., bioRxiv - Cell Biology 2021

  Quote: ... Treacle (HPA038237, Atlas Antibodies), NBS1 (1D7 ...
• A genome-wide CRISPR screen identifies UFMylation and TRAMP-like complexes as host factors required for hepatitis A virus infection

  Jessie Kulsuptrakul, et al., bioRxiv - Microbiology 2020

  Quote: ... PAPD5 (Atlas Antibodies, HPA042968) at 1:1000 and ZCCHC14 (Bethyl ...
• Loss of HMCES is synthetic lethal with APOBEC activity in cancer cells

  Josep Biayna, et al., bioRxiv - Cancer Biology 2021

  Quote: ... HMCES (HPA044968, Atlas Antibodies). The HMCES knockdown stable cell lines (HCC-78 ...
• ZDHHC5 targets Protocadherin 7 to the cell surface by a palmitoylation-dependent mechanism to promote successful cytokinesis

  Nazlı Ezgi Özkan Küçük, et al., bioRxiv - Cell Biology 2022

  Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670). Alexa Fluor®-488 and Alexa Fluor®-555 (Cell Signaling) ...
• ZDHHC5 targets Protocadherin 7 to the cell surface by a palmitoylation-dependent mechanism to promote successful cytokinesis

  Nazlı Ezgi Özkan Küçük, et al., bioRxiv - Cell Biology 2022

  Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670), Calnexin (Abcam ...
• Hyaluronic Acid Fuels Pancreatic Cancer Growth

  Peter K. Kim, et al., bioRxiv - Cancer Biology 2020

  Quote: ... NAGK (Atlas Antibodies HPA035207), O-GlcNAc (Abcam 2735) ...
• Cell-surface tethered promiscuous biotinylators enable small-scale surface proteomics of human exosomes

  Lisa L. Kirkemo, et al., bioRxiv - Biochemistry 2021

  Quote: ... ITIH4 (Atlas Antibodies, HPA003948), MFGE8 (Thermo Scientific ...
• CLPTM1L is a lipid scramblase involved in glycosylphosphatidylinositol biosynthesis

  Yicheng Wang, et al., bioRxiv - Biochemistry 2021

  Quote: ... CLPTM1L (HPA014791, Atlas Antibodies), UBE2J1 (sc-377002 ...
• Adenine Nucleotide Translocase regulates the airway epithelium, mitochondrial metabolism and ciliary function

  Corrine R. Kliment, et al., bioRxiv - Cell Biology 2020

  Quote: ... NPHP4 (Atlas Antibodies, #HPA065526), GFP (Aves Labs Inc ...
• Long Non-Coding RNA Generated from CDKN1A Gene by Alternative Polyadenylation Regulates p21 Expression during DNA Damage Response

  Michael R. Murphy, et al., bioRxiv - Molecular Biology 2023

  Quote: ... GPD1 (HPA044620, Atlas Antibodies).
• The Drosophila MIC10 orthologue has a propensity to polymerize into cristae-shaping filaments

  Till Stephan, et al., bioRxiv - Cell Biology 2023

  Quote: ... MIC19 (Atlas Antibodies, HPA042935), COX3 (Proteintech ...
• A palmitoyl transferase chemical genetic system to map ZDHHC-specific S-acylation

  Cory A. Ocasio, et al., bioRxiv - Molecular Biology 2023

  Quote: ... BCAP31 (Atlas Antibodies, HPA003906) and V5-epitope (SAB1306079 ...
• Plasma cells in human pancreatic ductal adenocarcinoma secrete antibodies to self-antigens

  Min Yao, et al., bioRxiv - Cancer Biology 2023

  Quote: ... RUVBL1 (Atlas Antibodies, # HPA019947), HSPD1 (Atlas Antibody ...
• Plasma cells in human pancreatic ductal adenocarcinoma secrete antibodies to self-antigens

  Min Yao, et al., bioRxiv - Cancer Biology 2023

  Quote: ... COX4I1 (Atlas antibody, #HPA002485), KRT19 (Abcam ...
• Plasma cells in human pancreatic ductal adenocarcinoma secrete antibodies to self-antigens

  Min Yao, et al., bioRxiv - Cancer Biology 2023

  Quote: ... MYH10 (Atlas Antibodies, #HPA047541), cytochalasin D (Thermo Fisher ...
• Plasma cells in human pancreatic ductal adenocarcinoma secrete antibodies to self-antigens

  Min Yao, et al., bioRxiv - Cancer Biology 2023

  Quote: ... HSPA9 (Atlas Antibody, #HPA000898), COX4I1 (Atlas antibody ...
• Plasma cells in human pancreatic ductal adenocarcinoma secrete antibodies to self-antigens

  Min Yao, et al., bioRxiv - Cancer Biology 2023

  Quote: ... RUVBL2 (Atlas Antibodies, #HPA067966), RUVBL1 (Atlas Antibodies ...
• Plasma cells in human pancreatic ductal adenocarcinoma secrete antibodies to self-antigens

  Min Yao, et al., bioRxiv - Cancer Biology 2023

  Quote: ... HSPD1 (Atlas Antibody, #HPA050025), HSPA9 (Atlas Antibody ...
• Partitioning heritability using single-cell multi-omics identifies a novel macrophage subpopulation conveying genetic risks of coronary artery disease

  Jiahao Jiang, et al., bioRxiv - Genetics 2023

  Quote: ... MITF (HPA003259, Atlas Antibodies) 1:100 and tubulin-AF488 (clone DM1A ...
• iPSC-derived models of PACS1 syndrome reveal transcriptional and functional deficits in neuron activity

  Lauren Rylaarsdam, et al., bioRxiv - Neuroscience 2023

  Quote: ... EMX1 (Atlas Antibodies, HPA006421); LHX9 (Sigma ...
• Prolonged over-expression of PLK4 amplifies centrosomes through formation of inter-connected centrosome rosette clusters

  Selahattin Can Özcan, et al., bioRxiv - Cell Biology 2023

  Quote: ... CEP120 (Atlas Antibodies; HPA028823): 1/500 ...
• Proximal protein landscapes of the type I interferon signaling cascade reveal negative regulation by the E3 ubiquitin ligase PJA2

  Samira Schiefer, Benjamin G. Hale, bioRxiv - Immunology 2023

  Quote: ... KLC2 (Atlas Antibodies, HPA040416), CNOT1 (Cell Signaling Technology ...
• N-6-methyladenosine (m6A) Promotes the Nuclear Retention of mRNAs with Intact 5’ Splice Site Motifs

  Eliza S. Lee, et al., bioRxiv - Molecular Biology 2023

  Quote: ... ALKBH5 (Atlas Antibodies, HPA007196), ZFC3H1 (Bethyl laboratories ...
• A missense KCNQ1 Mutation Impairs Insulin Secretion in Neonatal Diabetes

  Zhimin Zhou, et al., bioRxiv - Cell Biology 2021

  Quote: ... The PVDF membrane was blocked and then incubated with KCNQ1 antibodies (ATLAS ANTIBODIES) overnight at 4°C ...
• Enhanced hippocampal LTP but typical NMDA receptor and AMPA receptor function in a novel rat model of CDKL5 deficiency disorder

  L Simões de Oliveira, et al., bioRxiv - Neuroscience 2022

  Quote: ... followed by overnight incubation with primary antibodies (CDKL5- 1:1000, #HPA002847, Atlas Antibodies-Sigma Aldrich ...
• Nuclear dengue virus NS5 antagonizes expression of PAF1-dependent immune response genes

  Marine J. Petit, et al., bioRxiv - Microbiology 2021

  Quote: ... For the microscopy we used the following antibodies: PAF1 1:500 (Atlas antibodies, HPA043637), Strep 1:1000 (Qiagen ...
• ZC3H4 restricts non-coding transcription in human cells

  Chris Estell, et al., bioRxiv - Molecular Biology 2021

  Quote: ... or ZC3H4 (HPA040934, Atlas Antibodies) were used for immunoprecipitation ...
• Concerted action of kinesins KIF5B and KIF13B promotes efficient secretory vesicle transport to microtubule plus ends

  Andrea Serra-Marques, et al., bioRxiv - Cell Biology 2020

  Quote: ... (Atlas Antibodies, Cat# HPA028075, RRID:AB_10603778), MAP7D3 (Atlas Antibodies ...
• A homozygous genome-edited Sept2-EGFP fibroblast cell line

  Monika Banko, et al., bioRxiv - Cell Biology 2019

  Quote: ... Sept9 (SIGMA Atlas Antibodies HPA042564), Sept11 (kind gift from Bill Trimble) ...
• A homozygous genome-edited Sept2-EGFP fibroblast cell line

  Monika Banko, et al., bioRxiv - Cell Biology 2019

  Quote: Sept2 (SIGMA Atlas Antibodies HPA018481), Sept7 (IBL JP18991) ...
• A homozygous genome-edited Sept2-EGFP fibroblast cell line

  Monika Banko, et al., bioRxiv - Cell Biology 2019

  Quote: ... Sept9 (SIGMA Atlas Antibodies HPA042564), Sept11 (Millipore ABN1342) ...
• The protein expression profile of ACE2 in human tissues

  Feria Hikmet, et al., bioRxiv - Cell Biology 2020

  Quote: ... (Atlas Antibodies AB, Bromma, Sweden) and monoclonal mouse IgG antibody MAB933 ...
• MTCH2 is a mitochondrial outer membrane protein insertase

  Alina Guna, et al., bioRxiv - Cell Biology 2022

  Quote: ... CYB5B (HPA007893, Atlas antibodies, USA); MIRO2 (RHOT2 ...
• Peroxisomal tail-anchored proteins do not reach peroxisomes via ER, instead mitochondria can be involved

  Tamara Somborac, et al., bioRxiv - Cell Biology 2023

  Quote: ... 1:300 (Atlas Antibodies, HPA012145), chicken anti-GFP ...
• A murine model of hnRNPH2-related neurodevelopmental disorder recapitulates clinical features of human disease and reveals a mechanism for genetic compensation of HNRNPH2

  Ane Korff, et al., bioRxiv - Neuroscience 2023

  Quote: ... and FOXP2 (HPA000382, Atlas Antibodies), which is expressed in layer VI neurons ...
• p73 activates transcriptional signatures of basal lineage identity and ciliogenesis in pancreatic ductal adenocarcinoma

  Stella K. Hur, et al., bioRxiv - Cancer Biology 2023

  Quote: ... FOXJ1 (Atlas antibodies, Cat# HPA005714) at 1:700 ...
• Targeted protein degradation via intramolecular bivalent glues

  Oliver Hsia, et al., bioRxiv - Biochemistry 2023

  Quote: ... RBM39 (no. HPA001591, Atlas Antibodies), RBX1 (D3J5I ...