Labshake search

1 - 50 of 367 citations for RAB41 Member RAS Oncogene Family RAB41 Antibody since 2019

• TIRR regulates mRNA export and association with P bodies in response to DNA damage

  Michelle S Glossop, et al., bioRxiv - Molecular Biology 2024

  Quote: ... NUDT16L1 antibody (Atlas Antibodies) and CRM1 antibody (Santa Cruz ...
• Spatial visualization of A-to-I Editing in cells using Endonuclease V Immunostaining Assay (EndoVIA)

  Alexandria L. Quillin, et al., bioRxiv - Molecular Biology 2024

  Quote: ... or anti-ADAR1 antibody (Atlas Antibodies) in blocking buffer and incubated for 1 hour ...
• The distinct role of ALDH1A1 and ALDH1A3 in the regulation of prostate cancer metastases

  Ielizaveta Gorodetska, et al., bioRxiv - Cancer Biology 2021

  Quote: ... or anti-ALDH1A3-antibody (Atlas Antibodies, HPA046271) on the Ventana BenchMark (Roche ...
• A homozygous genome-edited Sept2-EGFP fibroblast cell line

  Monika Banko, et al., bioRxiv - Cell Biology 2019

  Quote: Primary antibodies: Sept2 (SIGMA Atlas Antibodies HPA018481), GFP (Roche 12600500) ...
• A mechanism of melanogenesis mediated by E-cadherin downregulation and its involvement in solar lentigines

  Daigo Inoue, et al., bioRxiv - Cell Biology 2023

  Quote: ... anti-Desmocollin-1 antibody (HPA012891, ATLAS ANTIBODIES). The secondary antibodies used were as follows ...
• Recruitment of the SNX17-Retriever recycling pathway regulates synaptic function and plasticity

  Pilar Rivero-Ríos, et al., bioRxiv - Cell Biology 2023

  Quote: Primary antibodies used were SNX17 rabbit polyclonal antibody (pAb) (1:200, HPA043867, Atlas Antibodies), SNX17 mouse monoclonal antibody (mAb ...
• m⁶A demethylase ALKBH5 promotes tumor cell proliferation by destabilizing IGF2BPs target genes and worsens the prognosis of patients with non-small cell lung cancer

  Kazuo Tsuchiya, et al., bioRxiv - Cancer Biology 2022

  Quote: ... Antibodies for ALKBH5 (HPA007196, Atlas Antibodies, Stockholm, Sweden) and FTO (Ab124892 ...
• Nasal delivery of single-domain antibodies improves symptoms of SARS-CoV-2 infection in an animal model

  Kei Haga, et al., bioRxiv - Microbiology 2021

  Quote: ... subsequent rabbit anti ACE2 antibody (HPA000288, Atlas Antibodies) and HRP conjugated anti rabbit IgG (7074S ...
• Coordination of asparagine uptake and asparagine synthetase expression is required for T cell activation

  Helen Carrasco Hope, et al., bioRxiv - Immunology 2020

  Quote: ... Primary antibodies (rabbit anti-ASNS – HPA029318, Atlas Antibodies, mouse anti-β actin ...
• Indisulam synergizes with palbociclib to induce senescence through inhibition of CDK2 kinase activity

  Ziva Pogacar, et al., bioRxiv - Cancer Biology 2021

  Quote: ... Antibody against RBM39 was purchased from Atlas Antibodies. Antibody against p16 was purchased from Proteintech.
• Manganese-dependent microRNA trimming by 3’→5’ exonucleases generates 14-nucleotide or shorter tiny RNAs

  GeunYoung Sim, et al., bioRxiv - Molecular Biology 2022

  Quote: ... anti-EXO5 antibody (0.4 μg/mL, Atlas Antibodies), and/or anti-alpha-tubulin antibody (1:000 μg/mL ...
• Microtubule binding of the human HAUS complex is directly controlled by importins and Ran-GTP

  Kseniya Ustinova, et al., bioRxiv - Cell Biology 2023

  Quote: ... Anti-HAUS tubulin antibodies (HAUS1 - HPA040652, Atlas antibodies, x500 dilution ...
• A fluid biomarker reveals loss of TDP-43 splicing repression in pre-symptomatic ALS

  Katherine E. Irwin, et al., bioRxiv - Molecular Biology 2023

  Quote: ... and a commercial antibody against the wild-type protein was used as the primary detection antibody (Anti-CTB-50L17.10 antibody produced in rabbit; Prestige Antibodies® Powered by Atlas Antibodies). A species-specific sulfo-tagged antibody (Anti Rabbit Antibody Goat SULFO-TAG Labeled ...
• Paraoxonase and acylated homoserine lactones in urine from patients with urinary tract infections

  John Lafleur, Richard L. Amdur, bioRxiv - Immunology 2019

  Quote: Primary antibody: polyclonal human PON1 from rabbit (Atlas Antibodies).
• Cyclin B1-Cdk1 binding to MAD1 links nuclear pore disassembly to chromosomal stability

  Mark Jackman, et al., bioRxiv - Cell Biology 2019

  Quote: ... Primary antibodies were diluted as follows: TPR (Atlas antibodies) 1/50 ...
• Genetic and compound screens uncover factors modulating cancer cell response to indisulam

  Ziva Pogacar, et al., bioRxiv - Cancer Biology 2021

  Quote: ... Antibody against RBM39 (HPA001591) was purchased from Atlas Antibodies. Antibody against SRPK1 (611072 ...
• A PATHWAY FOR T3 SIGNALING IN THE BRAIN TO IMPROVE THE VARIABLE EFFECTIVENESS OF THERAPY WITH L-T4

  Federico Salas-Lucia, et al., bioRxiv - Neuroscience 2022

  Quote: ... rabbit polyclonal anti-MCT8 antibody 1:400 (Atlas antibodies), rabbit polyclonal anti-D3 antibody (Novus Biologicals) ...
• Global loss of cellular m⁶A RNA methylation following infection with different SARS-CoV-2 variants

  Roshan Vaid, et al., bioRxiv - Molecular Biology 2022

  Quote: ... anti-METTL14 rabbit antibody (1:300, HPA038002; Atlas Antibodies), anti-α-Tubulin mouse antibody (1:1000 ...
• The ER tether VAPA is required for proper cell motility and anchors ER-PM contact sites to focal adhesions

  Hugo Siegfried, et al., bioRxiv - Cell Biology 2023

  Quote: ... rabbit anti-VAPB polyclonal antibody (Atlas antibody HPA 013144), mouse anti-VAPA monoclonal antibody (Sigma 10355-4C12 ...
• Endosomal LRBA regulates the endo-lysosomal pathway

  Viktória Szentgyörgyi, et al., bioRxiv - Immunology 2024

  Quote: ... rabbit polyclonal LRBA antibody (#HPA023567, Atlas Antibodies, 1:1000), mouse AP1 100/3 hybridoma antibody (home-made) ...
• Nhlh1 and Nhlh2, a global transcriptional mechanism regulating commissural axon projection via Robo3 activation

  Aki Masuda, et al., bioRxiv - Neuroscience 2022

  Quote: ... The primary antibodies used were: rabbit anti-Barhl1 polyclonal antibody (Atlas Antibodies, HPA004809, Sigma, 1:500), goat anti-Robo3 polyclonal antibody (R&D Systems ...
• m⁶A demethylase ALKBH5 promotes tumor cell proliferation by destabilizing IGF2BPs target genes and worsens the prognosis of patients with non-small cell lung cancer

  Kazuo Tsuchiya, et al., bioRxiv - Cancer Biology 2022

  Quote: ... Primary antibodies for ALKBH5 (1:1000 dilution, HPA007196; Atlas Antibodies), FTO (1:1000 dilution ...
• Hematological and Neurological Expressed 1 (HN1): a predictive and pharmacodynamic biomarker of metformin response in endometrial cancers

  Nicholas W. Bateman, et al., bioRxiv - Cancer Biology 2019

  Quote: Rabbit polyclonal anti-HN1 antibody was purchased from Atlas Antibodies (Sigma-Aldrich - HPA059729 ...
• Paraoxonase and acylated homoserine lactones in urine from patients with urinary tract infections-- relationship to microbial diversity by 16S rRNA gene sequencing

  John Lafleur, et al., bioRxiv - Microbiology 2021

  Quote: Primary antibody: polyclonal human PON1 from rabbit (HPA001610, Atlas Antibodies). Secondary antibody ...
• hC9ORF78 localizes to kinetochores and is required for proper chromosome segregation

  Radhika Koranne, et al., bioRxiv - Cell Biology 2021

  Quote: ... and probed with antibodies to hC9ORF78 (Atlas antibodies and Bethyl), α-tubulin (Sigma) ...
• Host poly(A) polymerases PAPD5 and PAPD7 provide two layers of protection that ensure the integrity and stability of hepatitis B virus RNA

  Fei Liu, et al., bioRxiv - Microbiology 2021

  Quote: ... anti-PAPD5 antibody (Atlas Antibodies cat. no. HPA042968, Bromma, Sweden), and anti-beta Actin antibody (Abcam cat ...
• Multi-omic Analysis of Primary Human Kidney Tissues Identifies Medulla-Specific Gene Expression Patterns

  Stefan Haug, et al., bioRxiv - Genetics 2022

  Quote: ... polyclonal rabbit primary antibodies reactive against POU3F3 (Atlas Antibodies, HPA067151) were applied to the tissue sections at 0.5 µg/ml overnight at 4°C ...
• BIN1 regulates actin-membrane interactions during IRSp53-dependent filopodia formation

  Laura Picas, et al., bioRxiv - Cell Biology 2023

  Quote: ... polyclonal rabbit antibody to IRSp53 (BAIAP2) from Atlas Antibodies (HPA023310), HRP-conjugated beta actin monoclonal antibody from Proteintech (HRP-60008) ...
• Brain DNA methylomic analysis of frontotemporal lobar degeneration reveals OTUD4 in shared dysregulated signatures across pathological subtypes

  Katherine Fodder, et al., bioRxiv - Neuroscience 2023

  Quote: ... The rabbit anti-OTUD4 antibody (Atlas Antibodies HPA036623, 1:200) was used ...
• Critical role of PCYT2 in muscle health and aging

  Domagoj Cikes, et al., bioRxiv - Genetics 2023

  Quote: ... incubated with primary anti-Pcyt2 antibody (HPA023033, Atlas Antibodies, Sweden) Followed by and a HRP-labelled secondary Anti-rabbit antibody (#7074 ...
• The N6-methyladenosine demethylase ALKBH5 regulates the hypoxic HBV transcriptome

  Senko Tsukuda, et al., bioRxiv - Molecular Biology 2023

  Quote: ... Primary antibodies used in this study are ALKBH5 (Atlas Antibodies), β Actin (Sigma) ...
• Activation of a neural stem cell transcriptional program in parenchymal astrocytes

  Jens P. Magnusson, et al., bioRxiv - Neuroscience 2020

  Quote: ... Cux2 (Atlas Antibodies, Stockholm ...
• Sugar transporter Slc37a2 regulates bone metabolism via a dynamic tubular lysosomal network in osteoclasts

  Pei Ying Ng, et al., bioRxiv - Cell Biology 2022

  Quote: ... Ctsb (Atlas Antibodies, Sigma Aldrich HPA018156 ...
• Deep topographic proteomics of a human brain tumour

  Simon Davis, et al., bioRxiv - Cancer Biology 2023

  Quote: ... HPA000962 (Atlas Antibodies); rabbit anti-ASPH ...
• Host ZCCHC3 blocks HIV-1 infection and production by a dual mechanism

  Binbin Yi, et al., bioRxiv - Microbiology 2023

  Quote: ... The following primary antibodies were used: anti-LSM14A rabbit polyclonal antibody (1: 500; HPA017961, Atlas Antibodies, Stockholm, Sweden), anti-p24 mouse monoclonal antibody (1 ...
• Nup93 and CTCF co-modulate spatiotemporal dynamics and function of the HOXA gene cluster during differentiation

  Ajay S. Labade, et al., bioRxiv - Molecular Biology 2019

  Quote: ... rabbit anti-Nup205 antibody (1:500, HPA024574, Lot-R11937, ATLAS antibodies) and rabbit anti-CTCF antibody (1:500 ...
• Cytosolic localization and in vitro assembly of human de novo thymidylate synthesis complex

  Sharon Spizzichino, et al., bioRxiv - Biochemistry 2021

  Quote: the following antibodies were used: rabbit anti-SHMT1 (HPA0233314, Atlas antibodies); mouse anti-DHFR (WH0001719M1 ...
• The Effect of Radiotherapy on Head and Neck Cancer Cell Lines Following Exposure to Heat

  Ben Atkinson, Jamie Wilson, bioRxiv - Cancer Biology 2020

  Quote: ... Specific antibodies against ATR 1:1000 (Atlas antibodies Cat no. HPA054320) and ATR S428 1:2000 (cell signalling Cat no ...
• EMX2 transcriptionally regulates Nfib expression in neural progenitor cells during early cortical development

  Jonathan W. C. Lim, et al., bioRxiv - Neuroscience 2021

  Quote: ... The primary antibodies used were rabbit anti-EMX2 (HPA065294, Atlas Antibodies) and normal rabbit IgG (#2729 ...
• Transcriptomic profiling implicates PAF1 in both active and repressive immune regulatory networks

  Matthew W. Kenaston, et al., bioRxiv - Molecular Biology 2022

  Quote: ... PAF1 primary antibody was diluted at 1:500 (Atlas antibodies, HPA043637). AlexaFluor555 and Hoechst33342 ...
• RBPMS promotes contractile smooth muscle splicing and alters phenotypic behaviour of human embryonic stem cell derived vascular smooth muscle cells

  Aishwarya G Jacob, et al., bioRxiv - Molecular Biology 2022

  Quote: ... Antibodies used were anti-RBPMS (Atlas antibodies HPA056999, 1:1000 dil), anti-RBFOX2 (Atlas antibodies HPA006240 – 1:500 dil) ...
• Lymphotoxin-β Promotes Bone Colonization and Osteolytic Outgrowth of Indolent Bone Metastatic cells of Breast Cancer

  Xuxiang Wang, et al., bioRxiv - Cell Biology 2023

  Quote: ... the slides were incubated with α-LTβ antibody (Atlas Antibodies, HPA048884) at a 1:100 dilution for 1 hour at room temperature ...
• AAV-mediated gene therapy in a GLDC-deficient mouse model of Non-Ketotic Hyperglycinemia

  Kit-Yi Leung, et al., bioRxiv - Molecular Biology 2023

  Quote: ... GLDC protein abundance was determined using anti-GLDC antibody (Atlas antibodies), with GAPDH (detected using anti-GAPDH ...
• Single-cell image-based genetic screens systematically identify regulators of Ebola virus subcellular infection dynamics

  Rebecca J. Carlson, et al., bioRxiv - Microbiology 2024

  Quote: ... and immunostained with our anti-EBOV VP35 mouse antibody and an anti-STRAP rabbit antibody (Atlas Antibodies, Bromma, Sweden) at 1:3000 and 1:1000 respectively for several hours at 37°C ...
• m⁶A demethylase ALKBH5 promotes tumor cell proliferation by destabilizing IGF2BPs target genes and worsens the prognosis of patients with non-small cell lung cancer

  Kazuo Tsuchiya, et al., bioRxiv - Cancer Biology 2022

  Quote: ... the cells were probed with primary antibodies against ALKBH5 (HPA007196, Atlas Antibodies) and then incubated with a Goat anti-Rabbit IgG (H + L ...
• 53BP1 mediated recruitment of RASSF1A at ribosomal DNA breaks facilitates local ATM signal amplification

  Stavroula Tsaridou, et al., bioRxiv - Cell Biology 2021

  Quote: The following antibodies were used in this study: RASSF1A (HPA040735, Atlas Antibodies), RASSF1A (3F3 ...
• ORMDL1 is upregulated and associated with favorable outcome in colorectal cancer

  Qian Wang, et al., bioRxiv - Cancer Biology 2020

  Quote: ... and incubated in the anti-ORMDL1 antibody (1:100, PHA065643, Atlas Antibodies) overnight at 4℃ ...
• ORMDL1 is upregulated and associated with favorable outcome in colorectal cancer

  Qian Wang, et al., bioRxiv - Cancer Biology 2020

  Quote: ... After being incubated with anti-ORMDL1 antibody (1:100, PHA065643, Atlas Antibodies) and following secondary antibody according to product manual ...
• Identification of protein aggregates in the aging vertebrate brain with prion-like and phase separation properties

  Itamar Harel, et al., bioRxiv - Neuroscience 2022

  Quote: ... Primary antibodies used were the following: DDX5 (Atlas Antibodies, HPA020043, [1:200]) and NeuN (Millipore ...
• Actin chromobody imaging reveals sub-organellar actin dynamics

  Cara R. Schiavon, et al., bioRxiv - Cell Biology 2019

  Quote: ... made by Prestige Antibodies Powered by Atlas Antibodies (Sigma-Aldrich, catalog #: HPA017430). The amino acid sequence of the antigen is MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGS KEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.