Labshake search
Citations for Atlas Antibodies AB :
201 - 250 of 367 citations for Mouse Anti Zika Virus NS1 Antibody B4 Biotin Conjugate since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2021Quote: ... rabbit anti-DNMT3B (0.4 μg/mL [1:500], 30 minutes with ER1; HPA001595, Atlas Antibodies), and rabbit anti-p62 (1:2000 ...
-
bioRxiv - Molecular Biology 2024Quote: ... NUDT16L1 antibody (Atlas Antibodies) and CRM1 antibody (Santa Cruz ...
-
bioRxiv - Cell Biology 2022Quote: ... Sperm were then incubated with either anti-SAXO1 (HPA023899 from Atlas Antibodies, used at 2 μg/mL), anti-SPACA9 (HPA022243 from Atlas Antibodies ...
-
bioRxiv - Cell Biology 2023Quote: ... and rabbit anti-glucagon/pro-glucagon (GCG; Cat. No. HPA036761; Atlas Antibodies, Stockholm, Sweden; diluted 1:1000). Following incubation with primary antibodies ...
-
bioRxiv - Cell Biology 2019Quote: Primary antibodies: Sept2 (SIGMA Atlas Antibodies HPA018481), GFP (Roche 12600500) ...
-
bioRxiv - Cell Biology 2023Quote: Primary antibodies used were SNX17 rabbit polyclonal antibody (pAb) (1:200, HPA043867, Atlas Antibodies), SNX17 mouse monoclonal antibody (mAb ...
-
bioRxiv - Neuroscience 2021Quote: The antisera used in this study included: (1) rabbit anti-NFIA was used at 1:300 (HPA006111; Atlas Antibodies). This antibody was raised to Recombinant Protein Epitope Signature Tag (PrEST ...
-
bioRxiv - Cancer Biology 2022Quote: ... Antibodies for ALKBH5 (HPA007196, Atlas Antibodies, Stockholm, Sweden) and FTO (Ab124892 ...
-
bioRxiv - Cancer Biology 2021Quote: ... Antibody against RBM39 was purchased from Atlas Antibodies. Antibody against p16 was purchased from Proteintech.
-
bioRxiv - Immunology 2019Quote: Primary antibody: polyclonal human PON1 from rabbit (Atlas Antibodies).
-
bioRxiv - Cell Biology 2019Quote: ... Primary antibodies were diluted as follows: TPR (Atlas antibodies) 1/50 ...
-
bioRxiv - Cancer Biology 2021Quote: ... Antibody against RBM39 (HPA001591) was purchased from Atlas Antibodies. Antibody against SRPK1 (611072 ...
-
bioRxiv - Immunology 2024Quote: ... rabbit polyclonal LRBA antibody (#HPA023567, Atlas Antibodies, 1:1000), mouse AP1 100/3 hybridoma antibody (home-made) ...
-
bioRxiv - Cell Biology 2023Quote: ... The rabbit anti-TLNRD1 used to stain the brain section was purchased from Atlas Antibodies (1:200 for IF, HPA071716). Other rabbit antibodies used in this study include anti-KRIT1 (1:1000 for WB ...
-
bioRxiv - Cancer Biology 2022Quote: ... Primary antibodies for ALKBH5 (1:1000 dilution, HPA007196; Atlas Antibodies), FTO (1:1000 dilution ...
-
bioRxiv - Microbiology 2021Quote: Primary antibody: polyclonal human PON1 from rabbit (HPA001610, Atlas Antibodies). Secondary antibody ...
-
bioRxiv - Cell Biology 2021Quote: ... and probed with antibodies to hC9ORF78 (Atlas antibodies and Bethyl), α-tubulin (Sigma) ...
-
bioRxiv - Genetics 2022Quote: ... polyclonal rabbit primary antibodies reactive against POU3F3 (Atlas Antibodies, HPA067151) were applied to the tissue sections at 0.5 µg/ml overnight at 4°C ...
-
bioRxiv - Cell Biology 2023Quote: ... polyclonal rabbit antibody to IRSp53 (BAIAP2) from Atlas Antibodies (HPA023310), HRP-conjugated beta actin monoclonal antibody from Proteintech (HRP-60008) ...
-
bioRxiv - Molecular Biology 2023Quote: ... Primary antibodies used in this study are ALKBH5 (Atlas Antibodies), β Actin (Sigma) ...
-
bioRxiv - Neuroscience 2020Quote: ... Cux2 (Atlas Antibodies, Stockholm ...
-
bioRxiv - Cell Biology 2022Quote: ... Ctsb (Atlas Antibodies, Sigma Aldrich HPA018156 ...
-
bioRxiv - Cancer Biology 2023Quote: ... HPA000962 (Atlas Antibodies); rabbit anti-ASPH ...
-
bioRxiv - Cancer Biology 2020Quote: ... Specific antibodies against ATR 1:1000 (Atlas antibodies Cat no. HPA054320) and ATR S428 1:2000 (cell signalling Cat no ...
-
bioRxiv - Molecular Biology 2022Quote: ... PAF1 primary antibody was diluted at 1:500 (Atlas antibodies, HPA043637). AlexaFluor555 and Hoechst33342 ...
-
bioRxiv - Cell Biology 2023Quote: ... the slides were incubated with α-LTβ antibody (Atlas Antibodies, HPA048884) at a 1:100 dilution for 1 hour at room temperature ...
-
bioRxiv - Neuroscience 2020Quote: ... then overnight at room temperature in Triton PBS containing 1% v/v NDS and rabbit anti-FoxP2 (1:1000; HPA000382, Atlas Antibodies, RRID:AB_1078908), then washed in PBS ...
-
bioRxiv - Neuroscience 2020Quote: ... encompasses the shorter C-terminal peptide (75 amino acids and corresponding to amino acids 2446-2521 of the human PIEZO2 protein) that was used to generate the commercially available anti-PIEZO2 Ab (Atlas antibodies, HPA015986). This Atlas Ab was one of three antibodies used by the Human Protein Atlas group to study PIEZO2 expression in the human brain.1
-
bioRxiv - Cancer Biology 2022Quote: ... the cells were probed with primary antibodies against ALKBH5 (HPA007196, Atlas Antibodies) and then incubated with a Goat anti-Rabbit IgG (H + L ...
-
bioRxiv - Cell Biology 2021Quote: The following antibodies were used in this study: RASSF1A (HPA040735, Atlas Antibodies), RASSF1A (3F3 ...
-
bioRxiv - Neuroscience 2022Quote: ... Primary antibodies used were the following: DDX5 (Atlas Antibodies, HPA020043, [1:200]) and NeuN (Millipore ...
-
bioRxiv - Cell Biology 2019Quote: ... made by Prestige Antibodies Powered by Atlas Antibodies (Sigma-Aldrich, catalog #: HPA017430). The amino acid sequence of the antigen is MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGS KEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.
-
bioRxiv - Biophysics 2021Quote: ... Binding of primary antibody (Elys (catalog no. HPA031658, Atlas Antibodies, 1:50), Nup133 (catalog no ...
-
bioRxiv - Cell Biology 2023Quote: ... or in 4% fetal bovine serum for antibodies acquired from ATLAS antibodies for at least 40 minuntes at RT ...
-
bioRxiv - Cell Biology 2023Quote: ... Primary antibodies used included SNX17 rabbit pAb (1:1000, HPA043867, Atlas Antibodies), SNX17 mouse mAb ...
-
bioRxiv - Cell Biology 2023Quote: ... Antibodies against GOLGA1_1 Golgin-97 (cat: HPA044329) were purchased from Atlas Antibodies. Antibodies against LMAN1 ERGIC-53 (cat ...
-
bioRxiv - Molecular Biology 2021Quote: ... ZC3H4 (HPA040934, Atlas Antibodies), HA tag (clone 3f10 ...
-
bioRxiv - Developmental Biology 2019Quote: ... KLF17 (Atlas Antibodies HPA024629), TFCP2L1 (R&D Systems AF5726) ...
-
bioRxiv - Cell Biology 2019Quote: ... MIC27 (Atlas Antibodies, HPA000612), MIC60 (custom-made ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and Tubulin (T6199 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies), PABPN1 (LS-B8482 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and specific myosin heavy chain isotype were stained with MyHC-2a and MyHC-2b conjugated to 594 and 488 fluorophore ...
-
bioRxiv - Immunology 2019Quote: ... and FATP3 (Atlas antibodies) were measured in conjunction with goat anti-rabbit AF488 (Abcam) ...
-
bioRxiv - Cancer Biology 2021Quote: ... NAGK (Atlas Antibodies, HPA035207), and PARP (Cell Signaling 9532).
-
bioRxiv - Cell Biology 2021Quote: ... Treacle (HPA038237, Atlas Antibodies), NBS1 (1D7 ...
-
bioRxiv - Microbiology 2020Quote: ... PAPD5 (Atlas Antibodies, HPA042968) at 1:1000 and ZCCHC14 (Bethyl ...
-
bioRxiv - Cancer Biology 2021Quote: ... HMCES (HPA044968, Atlas Antibodies). The HMCES knockdown stable cell lines (HCC-78 ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670). Alexa Fluor®-488 and Alexa Fluor®-555 (Cell Signaling) ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670), Calnexin (Abcam ...
-
bioRxiv - Cancer Biology 2020Quote: ... NAGK (Atlas Antibodies HPA035207), O-GlcNAc (Abcam 2735) ...