Labshake search
Citations for Atlas Antibodies AB :
251 - 300 of 367 citations for Mouse Anti Dengue Virus NS1 Serotype 1 Antibody OB4 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2022Quote: Anoctamin 8 (WB 1:500, #HPA049206, Atlas Antibodies), ARHGAP33 (Western-blotting (WB ...
-
bioRxiv - Cancer Biology 2021Quote: ... lamin b1 (#HPA050524, 1:1000 dilution, Atlas Antibodies), tubulin (#sc-53646 ...
-
bioRxiv - Biophysics 2021Quote: ... Nup133 (catalog no. HPA059767, Atlas Antibodies, 1:150), Nup62 (catalog no ...
-
bioRxiv - Cancer Biology 2022Quote: ... or 1:500 (Cat. No. HPA003446, Atlas antibodies) dilution.
-
bioRxiv - Neuroscience 2023Quote: ... and TRIOBP-1 (Atlas Antibodies, Stockholm, Sweden, HPA019769). Secondary antibodies were purchased from Thermo Fisher Scientific (31430 ...
-
CASC3 promotes transcriptome-wide activation of nonsense-mediated decay by the exon junction complexbioRxiv - Molecular Biology 2020Quote: ... anti-CASC3 amino acid residues 367-470 (Atlas Antibodies, #HPA024592), anti-EIF4A3 (Genscript) ...
-
bioRxiv - Cell Biology 2020Quote: ... polyclonal rabbit anti-human septin 2 (Atlas Antibodies, Cat. # HPA018481), mouse monoclonal anti-human GAPDH (clone 6C5) ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-SPACA9 (HPA022243 from Atlas Antibodies, used at 6 μg/mL), or no primary antibody diluted in blocking buffer for 2 h at RT ...
-
bioRxiv - Cancer Biology 2022Quote: ... anti-Collagen IV alpha 2 (3 μg/ml, Atlas Antibodies, #HPA069337), anti-LAMA5 (5 μg/ml ...
-
bioRxiv - Genetics 2022Quote: ... Ab #3 (1:1000 in BSA, HPA028760, Atlas antibodies) and Ab #4 (1:1000 in BSA ...
-
bioRxiv - Cancer Biology 2022Quote: ... AHDC1 (1:1000 dilution, Cat. No. HPA028648, Atlas antibodies), SOX2 (1:2000 dilution ...
-
bioRxiv - Cell Biology 2023Quote: ... VAPA polyclonal (HPA009174, Atlas Antibodies, host: Rabbit, 1:400), VAPB polyclonal (HPA013144 ...
-
bioRxiv - Cell Biology 2023Quote: ... VAPB polyclonal (HPA013144, Atlas Antibodies, host: Rabbit, 1:400), PI4K2A monoclonal (sc-390026 ...
-
bioRxiv - Molecular Biology 2023Quote: ... and incubated overnight at 4°C with primary antibodies against DCBLD1 (1:30, Atlas antibody, Bromma, Sweden) and CD31 (1:100 ...
-
bioRxiv - Neuroscience 2019Quote: ... Bach2 (1:2000; Sigma-Aldrich Cat# SAB2100201, or Atlas Antibodies Cat# HPA051384 ...
-
bioRxiv - Systems Biology 2021Quote: ... sections were incubated overnight at 4°C with the primary antibodies as follow: Anti-AMACR (rabbit polyclonal) (Atlas Antibodies, Sweden) at a dilution 1:2000 ...
-
bioRxiv - Neuroscience 2022Quote: ... Coronal whole brain slices (20µm) were incubated with primary antibody (Anti-PHGDH (3-Phosphoglycerate dehydrogenase; Atlas antibodies, Bromma, Sweden; HPA021241), Anti-SparcL1(Sparc-Like1 ...
-
bioRxiv - Biochemistry 2021Quote: ... The grids were then incubated with polyclonal antibody against human proSP-C (SFTPC) (1:200 dilution, Atlas Antibodies) overnight at 4°C ...
-
bioRxiv - Cell Biology 2022Quote: ... the total lysate was digested with RNase-I and immunoprecipitated with 10 µg of the following antibodies: anti-ZC3H11A (HPA028526 and HPA028490, Atlas Antibodies), anti-ALYREF (ab202894 ...
-
bioRxiv - Neuroscience 2021Quote: ... or NFIA (1:200 rabbit polyclonal; Atlas Antibodies cat. no. HPA008884) were then added in blocking buffer and incubated overnight at 4 °C ...
-
bioRxiv - Neuroscience 2022Quote: ... Sections were incubated overnight with primary antibodies in incubation buffer at 4°C (Hopx, 1:1000, HPA030180, Atlas Antibodies; Lpar1 ...
-
bioRxiv - Cell Biology 2023Quote: ... Cells were incubated for 1.5 hours at RT with the following primary antibodies: LBR (1:200, Atlas Antibodies HPA062236), LaminB1 (1:500 ...
-
bioRxiv - Molecular Biology 2020Quote: ... Primary human AKR1D1 (dilution 1/250 - HPA057002, Atlas Antibodies AB, Bromma, Sweden), β-tubulin (#15115 ...
-
bioRxiv - Cell Biology 2019Quote: ... Rabbit pAb against B4GALT1 (# HPA010807) (1:500 for IF) was from Atlas Antibodies. Sheep pAb against TGN46 (# AHP500G ...
-
bioRxiv - Molecular Biology 2024Quote: ... NUDT16L1 antibody (Atlas Antibodies) and CRM1 antibody (Santa Cruz ...
-
bioRxiv - Physiology 2022Quote: ... RREB1 (1:500, Sigma-Aldrich Cat# HPA001756, RRID:AB_1856477 and Atlas Antibodies Cat# HPA034843, RRID:AB_2674357) or β-tubulin (1:2,000 ...
-
bioRxiv - Cell Biology 2022Quote: ... Sperm were then incubated with either anti-SAXO1 (HPA023899 from Atlas Antibodies, used at 2 μg/mL), anti-SPACA9 (HPA022243 from Atlas Antibodies ...
-
bioRxiv - Cell Biology 2019Quote: Primary antibodies: Sept2 (SIGMA Atlas Antibodies HPA018481), GFP (Roche 12600500) ...
-
bioRxiv - Cancer Biology 2022Quote: ... Antibodies for ALKBH5 (HPA007196, Atlas Antibodies, Stockholm, Sweden) and FTO (Ab124892 ...
-
bioRxiv - Cancer Biology 2021Quote: ... Antibody against RBM39 was purchased from Atlas Antibodies. Antibody against p16 was purchased from Proteintech.
-
bioRxiv - Immunology 2019Quote: Primary antibody: polyclonal human PON1 from rabbit (Atlas Antibodies).
-
bioRxiv - Cell Biology 2019Quote: ... Primary antibodies were diluted as follows: TPR (Atlas antibodies) 1/50 ...
-
bioRxiv - Cancer Biology 2021Quote: ... Antibody against RBM39 (HPA001591) was purchased from Atlas Antibodies. Antibody against SRPK1 (611072 ...
-
bioRxiv - Microbiology 2021Quote: Primary antibody: polyclonal human PON1 from rabbit (HPA001610, Atlas Antibodies). Secondary antibody ...
-
bioRxiv - Cell Biology 2021Quote: ... and probed with antibodies to hC9ORF78 (Atlas antibodies and Bethyl), α-tubulin (Sigma) ...
-
bioRxiv - Genetics 2022Quote: ... polyclonal rabbit primary antibodies reactive against POU3F3 (Atlas Antibodies, HPA067151) were applied to the tissue sections at 0.5 µg/ml overnight at 4°C ...
-
bioRxiv - Cell Biology 2023Quote: ... polyclonal rabbit antibody to IRSp53 (BAIAP2) from Atlas Antibodies (HPA023310), HRP-conjugated beta actin monoclonal antibody from Proteintech (HRP-60008) ...
-
bioRxiv - Molecular Biology 2023Quote: ... Primary antibodies used in this study are ALKBH5 (Atlas Antibodies), β Actin (Sigma) ...
-
bioRxiv - Neuroscience 2020Quote: ... Cux2 (Atlas Antibodies, Stockholm ...
-
bioRxiv - Cell Biology 2022Quote: ... Ctsb (Atlas Antibodies, Sigma Aldrich HPA018156 ...
-
bioRxiv - Cancer Biology 2023Quote: ... HPA000962 (Atlas Antibodies); rabbit anti-ASPH ...
-
bioRxiv - Cell Biology 2023Quote: ... the slides were incubated with α-LTβ antibody (Atlas Antibodies, HPA048884) at a 1:100 dilution for 1 hour at room temperature ...
-
bioRxiv - Neuroscience 2020Quote: ... encompasses the shorter C-terminal peptide (75 amino acids and corresponding to amino acids 2446-2521 of the human PIEZO2 protein) that was used to generate the commercially available anti-PIEZO2 Ab (Atlas antibodies, HPA015986). This Atlas Ab was one of three antibodies used by the Human Protein Atlas group to study PIEZO2 expression in the human brain.1
-
bioRxiv - Cancer Biology 2022Quote: ... the cells were probed with primary antibodies against ALKBH5 (HPA007196, Atlas Antibodies) and then incubated with a Goat anti-Rabbit IgG (H + L ...
-
bioRxiv - Cell Biology 2021Quote: The following antibodies were used in this study: RASSF1A (HPA040735, Atlas Antibodies), RASSF1A (3F3 ...
-
bioRxiv - Cell Biology 2019Quote: ... made by Prestige Antibodies Powered by Atlas Antibodies (Sigma-Aldrich, catalog #: HPA017430). The amino acid sequence of the antigen is MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGS KEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.
-
bioRxiv - Cell Biology 2023Quote: ... or in 4% fetal bovine serum for antibodies acquired from ATLAS antibodies for at least 40 minuntes at RT ...
-
bioRxiv - Cell Biology 2023Quote: ... Antibodies against GOLGA1_1 Golgin-97 (cat: HPA044329) were purchased from Atlas Antibodies. Antibodies against LMAN1 ERGIC-53 (cat ...
-
bioRxiv - Molecular Biology 2021Quote: ... ZC3H4 (HPA040934, Atlas Antibodies), HA tag (clone 3f10 ...
-
bioRxiv - Developmental Biology 2019Quote: ... KLF17 (Atlas Antibodies HPA024629), TFCP2L1 (R&D Systems AF5726) ...