Labshake search
Citations for Atlas Antibodies AB :
201 - 250 of 367 citations for B TFIID TATA Box Binding Protein Associated Factor 1 BTAF1 Antibody Biotin since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2019Quote: Primary antibodies: Sept2 (SIGMA Atlas Antibodies HPA018481), GFP (Roche 12600500) ...
-
bioRxiv - Microbiology 2021Quote: ... The following antibodies were diluted in WB-buffer (PBS, 1% BSA, 0.05% Tween, 0.01% Na Azide): rabbit anti-human TMPRSS2 (Atlas antibodies cat# HPA035787, 1:1,000), rabbit anti-human actin (Sigma cat#A2066 ...
-
bioRxiv - Cancer Biology 2022Quote: ... Antibodies for ALKBH5 (HPA007196, Atlas Antibodies, Stockholm, Sweden) and FTO (Ab124892 ...
-
bioRxiv - Microbiology 2021Quote: ... subsequent rabbit anti ACE2 antibody (HPA000288, Atlas Antibodies) and HRP conjugated anti rabbit IgG (7074S ...
-
bioRxiv - Immunology 2020Quote: ... Primary antibodies (rabbit anti-ASNS – HPA029318, Atlas Antibodies, mouse anti-β actin ...
-
bioRxiv - Cancer Biology 2021Quote: ... Antibody against RBM39 was purchased from Atlas Antibodies. Antibody against p16 was purchased from Proteintech.
-
bioRxiv - Molecular Biology 2022Quote: ... anti-EXO5 antibody (0.4 μg/mL, Atlas Antibodies), and/or anti-alpha-tubulin antibody (1:000 μg/mL ...
-
bioRxiv - Cell Biology 2023Quote: ... Anti-HAUS tubulin antibodies (HAUS1 - HPA040652, Atlas antibodies, x500 dilution ...
-
bioRxiv - Immunology 2024Quote: ... for 1 hour at room temperature (RT) and incubated overnight at 4°C with anti-ANKRD55 rabbit polyclonal (1:500; Atlas Antibodies, Cat. No. HPA051049) or anti-FLAG (DDDDK tag ...
-
bioRxiv - Molecular Biology 2023Quote: ... and a commercial antibody against the wild-type protein was used as the primary detection antibody (Anti-CTB-50L17.10 antibody produced in rabbit; Prestige Antibodies® Powered by Atlas Antibodies). A species-specific sulfo-tagged antibody (Anti Rabbit Antibody Goat SULFO-TAG Labeled ...
-
bioRxiv - Cell Biology 2023Quote: ... and rabbit anti-glucagon/pro-glucagon (GCG; Cat. No. HPA036761; Atlas Antibodies, Stockholm, Sweden; diluted 1:1000). Following incubation with primary antibodies ...
-
bioRxiv - Immunology 2019Quote: Primary antibody: polyclonal human PON1 from rabbit (Atlas Antibodies).
-
bioRxiv - Cell Biology 2019Quote: ... Primary antibodies were diluted as follows: TPR (Atlas antibodies) 1/50 ...
-
bioRxiv - Cancer Biology 2021Quote: ... Antibody against RBM39 (HPA001591) was purchased from Atlas Antibodies. Antibody against SRPK1 (611072 ...
-
bioRxiv - Cell Biology 2023Quote: ... rabbit anti-VAPB polyclonal antibody (Atlas antibody HPA 013144), mouse anti-VAPA monoclonal antibody (Sigma 10355-4C12 ...
-
bioRxiv - Cancer Biology 2019Quote: Rabbit polyclonal anti-HN1 antibody was purchased from Atlas Antibodies (Sigma-Aldrich - HPA059729 ...
-
bioRxiv - Microbiology 2021Quote: Primary antibody: polyclonal human PON1 from rabbit (HPA001610, Atlas Antibodies). Secondary antibody ...
-
bioRxiv - Cell Biology 2021Quote: ... and probed with antibodies to hC9ORF78 (Atlas antibodies and Bethyl), α-tubulin (Sigma) ...
-
bioRxiv - Microbiology 2021Quote: ... anti-PAPD5 antibody (Atlas Antibodies cat. no. HPA042968, Bromma, Sweden), and anti-beta Actin antibody (Abcam cat ...
-
bioRxiv - Genetics 2022Quote: ... polyclonal rabbit primary antibodies reactive against POU3F3 (Atlas Antibodies, HPA067151) were applied to the tissue sections at 0.5 µg/ml overnight at 4°C ...
-
bioRxiv - Genetics 2023Quote: ... incubated with primary anti-Pcyt2 antibody (HPA023033, Atlas Antibodies, Sweden) Followed by and a HRP-labelled secondary Anti-rabbit antibody (#7074 ...
-
bioRxiv - Cell Biology 2023Quote: ... polyclonal rabbit antibody to IRSp53 (BAIAP2) from Atlas Antibodies (HPA023310), HRP-conjugated beta actin monoclonal antibody from Proteintech (HRP-60008) ...
-
bioRxiv - Molecular Biology 2023Quote: ... Primary antibodies used in this study are ALKBH5 (Atlas Antibodies), β Actin (Sigma) ...
-
bioRxiv - Neuroscience 2020Quote: ... Cux2 (Atlas Antibodies, Stockholm ...
-
bioRxiv - Cell Biology 2022Quote: ... Ctsb (Atlas Antibodies, Sigma Aldrich HPA018156 ...
-
bioRxiv - Cancer Biology 2023Quote: ... HPA000962 (Atlas Antibodies); rabbit anti-ASPH ...
-
bioRxiv - Biochemistry 2021Quote: the following antibodies were used: rabbit anti-SHMT1 (HPA0233314, Atlas antibodies); mouse anti-DHFR (WH0001719M1 ...
-
bioRxiv - Neuroscience 2021Quote: ... The primary antibodies used were rabbit anti-EMX2 (HPA065294, Atlas Antibodies) and normal rabbit IgG (#2729 ...
-
bioRxiv - Cell Biology 2023Quote: ... the slides were incubated with α-LTβ antibody (Atlas Antibodies, HPA048884) at a 1:100 dilution for 1 hour at room temperature ...
-
bioRxiv - Microbiology 2024Quote: ... and immunostained with our anti-EBOV VP35 mouse antibody and an anti-STRAP rabbit antibody (Atlas Antibodies, Bromma, Sweden) at 1:3000 and 1:1000 respectively for several hours at 37°C ...
-
bioRxiv - Cancer Biology 2022Quote: ... the cells were probed with primary antibodies against ALKBH5 (HPA007196, Atlas Antibodies) and then incubated with a Goat anti-Rabbit IgG (H + L ...
-
bioRxiv - Cell Biology 2021Quote: The following antibodies were used in this study: RASSF1A (HPA040735, Atlas Antibodies), RASSF1A (3F3 ...
-
bioRxiv - Cell Biology 2019Quote: ... made by Prestige Antibodies Powered by Atlas Antibodies (Sigma-Aldrich, catalog #: HPA017430). The amino acid sequence of the antigen is MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGS KEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.
-
bioRxiv - Cell Biology 2023Quote: ... or in 4% fetal bovine serum for antibodies acquired from ATLAS antibodies for at least 40 minuntes at RT ...
-
bioRxiv - Cell Biology 2023Quote: ... Antibodies against GOLGA1_1 Golgin-97 (cat: HPA044329) were purchased from Atlas Antibodies. Antibodies against LMAN1 ERGIC-53 (cat ...
-
bioRxiv - Cell Biology 2023Quote: ... the membrane was incubated overnight with anti-MRPP1 antibody (Atlas Antibodies, HPA036671) at 1:1000 dilution or anti-GAPDH antibody (Novus Biologicals ...
-
bioRxiv - Cell Biology 2023Quote: ... The rabbit anti-TLNRD1 used to stain the brain section was purchased from Atlas Antibodies (1:200 for IF, HPA071716). Other rabbit antibodies used in this study include anti-KRIT1 (1:1000 for WB ...
-
bioRxiv - Molecular Biology 2021Quote: ... ZC3H4 (HPA040934, Atlas Antibodies), HA tag (clone 3f10 ...
-
bioRxiv - Developmental Biology 2019Quote: ... KLF17 (Atlas Antibodies HPA024629), TFCP2L1 (R&D Systems AF5726) ...
-
bioRxiv - Cell Biology 2019Quote: ... MIC27 (Atlas Antibodies, HPA000612), MIC60 (custom-made ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and Tubulin (T6199 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies), PABPN1 (LS-B8482 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and specific myosin heavy chain isotype were stained with MyHC-2a and MyHC-2b conjugated to 594 and 488 fluorophore ...
-
bioRxiv - Immunology 2019Quote: ... and FATP3 (Atlas antibodies) were measured in conjunction with goat anti-rabbit AF488 (Abcam) ...
-
bioRxiv - Cancer Biology 2021Quote: ... NAGK (Atlas Antibodies, HPA035207), and PARP (Cell Signaling 9532).
-
bioRxiv - Cell Biology 2021Quote: ... Treacle (HPA038237, Atlas Antibodies), NBS1 (1D7 ...
-
bioRxiv - Microbiology 2020Quote: ... PAPD5 (Atlas Antibodies, HPA042968) at 1:1000 and ZCCHC14 (Bethyl ...
-
bioRxiv - Cancer Biology 2021Quote: ... HMCES (HPA044968, Atlas Antibodies). The HMCES knockdown stable cell lines (HCC-78 ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670). Alexa Fluor®-488 and Alexa Fluor®-555 (Cell Signaling) ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670), Calnexin (Abcam ...