Labshake search
Citations for Atlas Antibodies AB :
201 - 250 of 367 citations for Anti NPR1 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2024Quote: ... NUDT16L1 antibody (Atlas Antibodies) and CRM1 antibody (Santa Cruz ...
-
bioRxiv - Cell Biology 2022Quote: ... Sperm were then incubated with either anti-SAXO1 (HPA023899 from Atlas Antibodies, used at 2 μg/mL), anti-SPACA9 (HPA022243 from Atlas Antibodies ...
-
bioRxiv - Cell Biology 2023Quote: ... and rabbit anti-glucagon/pro-glucagon (GCG; Cat. No. HPA036761; Atlas Antibodies, Stockholm, Sweden; diluted 1:1000). Following incubation with primary antibodies ...
-
bioRxiv - Cell Biology 2019Quote: Primary antibodies: Sept2 (SIGMA Atlas Antibodies HPA018481), GFP (Roche 12600500) ...
-
bioRxiv - Cell Biology 2023Quote: Primary antibodies used were SNX17 rabbit polyclonal antibody (pAb) (1:200, HPA043867, Atlas Antibodies), SNX17 mouse monoclonal antibody (mAb ...
-
bioRxiv - Neuroscience 2021Quote: The antisera used in this study included: (1) rabbit anti-NFIA was used at 1:300 (HPA006111; Atlas Antibodies). This antibody was raised to Recombinant Protein Epitope Signature Tag (PrEST ...
-
bioRxiv - Cancer Biology 2022Quote: ... Antibodies for ALKBH5 (HPA007196, Atlas Antibodies, Stockholm, Sweden) and FTO (Ab124892 ...
-
bioRxiv - Cancer Biology 2021Quote: ... Antibody against RBM39 was purchased from Atlas Antibodies. Antibody against p16 was purchased from Proteintech.
-
bioRxiv - Immunology 2019Quote: Primary antibody: polyclonal human PON1 from rabbit (Atlas Antibodies).
-
bioRxiv - Cell Biology 2019Quote: ... Primary antibodies were diluted as follows: TPR (Atlas antibodies) 1/50 ...
-
bioRxiv - Cancer Biology 2021Quote: ... Antibody against RBM39 (HPA001591) was purchased from Atlas Antibodies. Antibody against SRPK1 (611072 ...
-
bioRxiv - Immunology 2024Quote: ... rabbit polyclonal LRBA antibody (#HPA023567, Atlas Antibodies, 1:1000), mouse AP1 100/3 hybridoma antibody (home-made) ...
-
bioRxiv - Cell Biology 2023Quote: ... The rabbit anti-TLNRD1 used to stain the brain section was purchased from Atlas Antibodies (1:200 for IF, HPA071716). Other rabbit antibodies used in this study include anti-KRIT1 (1:1000 for WB ...
-
bioRxiv - Cancer Biology 2022Quote: ... Primary antibodies for ALKBH5 (1:1000 dilution, HPA007196; Atlas Antibodies), FTO (1:1000 dilution ...
-
bioRxiv - Microbiology 2021Quote: Primary antibody: polyclonal human PON1 from rabbit (HPA001610, Atlas Antibodies). Secondary antibody ...
-
bioRxiv - Cell Biology 2021Quote: ... and probed with antibodies to hC9ORF78 (Atlas antibodies and Bethyl), α-tubulin (Sigma) ...
-
bioRxiv - Genetics 2022Quote: ... polyclonal rabbit primary antibodies reactive against POU3F3 (Atlas Antibodies, HPA067151) were applied to the tissue sections at 0.5 µg/ml overnight at 4°C ...
-
bioRxiv - Cell Biology 2023Quote: ... polyclonal rabbit antibody to IRSp53 (BAIAP2) from Atlas Antibodies (HPA023310), HRP-conjugated beta actin monoclonal antibody from Proteintech (HRP-60008) ...
-
bioRxiv - Molecular Biology 2023Quote: ... Primary antibodies used in this study are ALKBH5 (Atlas Antibodies), β Actin (Sigma) ...
-
bioRxiv - Neuroscience 2020Quote: ... Cux2 (Atlas Antibodies, Stockholm ...
-
bioRxiv - Cell Biology 2022Quote: ... Ctsb (Atlas Antibodies, Sigma Aldrich HPA018156 ...
-
bioRxiv - Cancer Biology 2023Quote: ... HPA000962 (Atlas Antibodies); rabbit anti-ASPH ...
-
bioRxiv - Cancer Biology 2020Quote: ... Specific antibodies against ATR 1:1000 (Atlas antibodies Cat no. HPA054320) and ATR S428 1:2000 (cell signalling Cat no ...
-
bioRxiv - Molecular Biology 2022Quote: ... PAF1 primary antibody was diluted at 1:500 (Atlas antibodies, HPA043637). AlexaFluor555 and Hoechst33342 ...
-
bioRxiv - Cell Biology 2023Quote: ... the slides were incubated with α-LTβ antibody (Atlas Antibodies, HPA048884) at a 1:100 dilution for 1 hour at room temperature ...
-
bioRxiv - Neuroscience 2020Quote: ... then overnight at room temperature in Triton PBS containing 1% v/v NDS and rabbit anti-FoxP2 (1:1000; HPA000382, Atlas Antibodies, RRID:AB_1078908), then washed in PBS ...
-
bioRxiv - Neuroscience 2020Quote: ... encompasses the shorter C-terminal peptide (75 amino acids and corresponding to amino acids 2446-2521 of the human PIEZO2 protein) that was used to generate the commercially available anti-PIEZO2 Ab (Atlas antibodies, HPA015986). This Atlas Ab was one of three antibodies used by the Human Protein Atlas group to study PIEZO2 expression in the human brain.1
-
bioRxiv - Cancer Biology 2022Quote: ... the cells were probed with primary antibodies against ALKBH5 (HPA007196, Atlas Antibodies) and then incubated with a Goat anti-Rabbit IgG (H + L ...
-
bioRxiv - Cell Biology 2021Quote: The following antibodies were used in this study: RASSF1A (HPA040735, Atlas Antibodies), RASSF1A (3F3 ...
-
bioRxiv - Neuroscience 2022Quote: ... Primary antibodies used were the following: DDX5 (Atlas Antibodies, HPA020043, [1:200]) and NeuN (Millipore ...
-
bioRxiv - Cell Biology 2019Quote: ... made by Prestige Antibodies Powered by Atlas Antibodies (Sigma-Aldrich, catalog #: HPA017430). The amino acid sequence of the antigen is MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGS KEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.
-
bioRxiv - Biophysics 2021Quote: ... Binding of primary antibody (Elys (catalog no. HPA031658, Atlas Antibodies, 1:50), Nup133 (catalog no ...
-
bioRxiv - Cell Biology 2023Quote: ... or in 4% fetal bovine serum for antibodies acquired from ATLAS antibodies for at least 40 minuntes at RT ...
-
bioRxiv - Cell Biology 2023Quote: ... Primary antibodies used included SNX17 rabbit pAb (1:1000, HPA043867, Atlas Antibodies), SNX17 mouse mAb ...
-
bioRxiv - Cell Biology 2023Quote: ... Antibodies against GOLGA1_1 Golgin-97 (cat: HPA044329) were purchased from Atlas Antibodies. Antibodies against LMAN1 ERGIC-53 (cat ...
-
bioRxiv - Molecular Biology 2021Quote: ... ZC3H4 (HPA040934, Atlas Antibodies), HA tag (clone 3f10 ...
-
bioRxiv - Developmental Biology 2019Quote: ... KLF17 (Atlas Antibodies HPA024629), TFCP2L1 (R&D Systems AF5726) ...
-
bioRxiv - Cell Biology 2019Quote: ... MIC27 (Atlas Antibodies, HPA000612), MIC60 (custom-made ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and Tubulin (T6199 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies), PABPN1 (LS-B8482 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and specific myosin heavy chain isotype were stained with MyHC-2a and MyHC-2b conjugated to 594 and 488 fluorophore ...
-
bioRxiv - Immunology 2019Quote: ... and FATP3 (Atlas antibodies) were measured in conjunction with goat anti-rabbit AF488 (Abcam) ...
-
bioRxiv - Cancer Biology 2021Quote: ... NAGK (Atlas Antibodies, HPA035207), and PARP (Cell Signaling 9532).
-
bioRxiv - Cell Biology 2021Quote: ... Treacle (HPA038237, Atlas Antibodies), NBS1 (1D7 ...
-
bioRxiv - Microbiology 2020Quote: ... PAPD5 (Atlas Antibodies, HPA042968) at 1:1000 and ZCCHC14 (Bethyl ...
-
bioRxiv - Cancer Biology 2021Quote: ... HMCES (HPA044968, Atlas Antibodies). The HMCES knockdown stable cell lines (HCC-78 ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670). Alexa Fluor®-488 and Alexa Fluor®-555 (Cell Signaling) ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670), Calnexin (Abcam ...
-
bioRxiv - Cancer Biology 2020Quote: ... NAGK (Atlas Antibodies HPA035207), O-GlcNAc (Abcam 2735) ...
-
bioRxiv - Biochemistry 2021Quote: ... ITIH4 (Atlas Antibodies, HPA003948), MFGE8 (Thermo Scientific ...