Labshake search
Citations for Atlas Antibodies AB :
51 - 100 of 367 citations for Zinc Finger Protein 232 ZNF232 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2020Quote: ... After being incubated with anti-ORMDL1 antibody (1:100, PHA065643, Atlas Antibodies) and following secondary antibody according to product manual ...
-
bioRxiv - Neuroscience 2022Quote: ... Primary antibodies used were the following: DDX5 (Atlas Antibodies, HPA020043, [1:200]) and NeuN (Millipore ...
-
bioRxiv - Cell Biology 2019Quote: ... made by Prestige Antibodies Powered by Atlas Antibodies (Sigma-Aldrich, catalog #: HPA017430). The amino acid sequence of the antigen is MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGS KEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.
-
bioRxiv - Biophysics 2021Quote: ... Binding of primary antibody (Elys (catalog no. HPA031658, Atlas Antibodies, 1:50), Nup133 (catalog no ...
-
bioRxiv - Cell Biology 2023Quote: ... or in 4% fetal bovine serum for antibodies acquired from ATLAS antibodies for at least 40 minuntes at RT ...
-
bioRxiv - Cell Biology 2023Quote: ... Primary antibodies used included SNX17 rabbit pAb (1:1000, HPA043867, Atlas Antibodies), SNX17 mouse mAb ...
-
bioRxiv - Cell Biology 2023Quote: ... Antibodies against GOLGA1_1 Golgin-97 (cat: HPA044329) were purchased from Atlas Antibodies. Antibodies against LMAN1 ERGIC-53 (cat ...
-
bioRxiv - Cell Biology 2023Quote: ... the membrane was incubated overnight with anti-MRPP1 antibody (Atlas Antibodies, HPA036671) at 1:1000 dilution or anti-GAPDH antibody (Novus Biologicals ...
-
bioRxiv - Molecular Biology 2021Quote: ... ZC3H4 (HPA040934, Atlas Antibodies), HA tag (clone 3f10 ...
-
bioRxiv - Developmental Biology 2019Quote: ... KLF17 (Atlas Antibodies HPA024629), TFCP2L1 (R&D Systems AF5726) ...
-
bioRxiv - Cell Biology 2019Quote: ... MIC27 (Atlas Antibodies, HPA000612), MIC60 (custom-made ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and Tubulin (T6199 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies), PABPN1 (LS-B8482 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and specific myosin heavy chain isotype were stained with MyHC-2a and MyHC-2b conjugated to 594 and 488 fluorophore ...
-
bioRxiv - Immunology 2019Quote: ... and FATP3 (Atlas antibodies) were measured in conjunction with goat anti-rabbit AF488 (Abcam) ...
-
bioRxiv - Cancer Biology 2021Quote: ... NAGK (Atlas Antibodies, HPA035207), and PARP (Cell Signaling 9532).
-
bioRxiv - Cell Biology 2021Quote: ... Treacle (HPA038237, Atlas Antibodies), NBS1 (1D7 ...
-
bioRxiv - Microbiology 2020Quote: ... PAPD5 (Atlas Antibodies, HPA042968) at 1:1000 and ZCCHC14 (Bethyl ...
-
bioRxiv - Cancer Biology 2021Quote: ... HMCES (HPA044968, Atlas Antibodies). The HMCES knockdown stable cell lines (HCC-78 ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670). Alexa Fluor®-488 and Alexa Fluor®-555 (Cell Signaling) ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670), Calnexin (Abcam ...
-
bioRxiv - Cancer Biology 2020Quote: ... NAGK (Atlas Antibodies HPA035207), O-GlcNAc (Abcam 2735) ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-WASH1 (Atlas Antibodies, cat ...
-
bioRxiv - Biochemistry 2021Quote: ... ITIH4 (Atlas Antibodies, HPA003948), MFGE8 (Thermo Scientific ...
-
bioRxiv - Biochemistry 2021Quote: ... CLPTM1L (HPA014791, Atlas Antibodies), UBE2J1 (sc-377002 ...
-
bioRxiv - Cell Biology 2020Quote: ... NPHP4 (Atlas Antibodies, #HPA065526), GFP (Aves Labs Inc ...
-
bioRxiv - Cell Biology 2023Quote: ... MIC19 (Atlas Antibodies, HPA042935), COX3 (Proteintech ...
-
bioRxiv - Molecular Biology 2023Quote: ... GPD1 (HPA044620, Atlas Antibodies).
-
bioRxiv - Molecular Biology 2023Quote: ... BCAP31 (Atlas Antibodies, HPA003906) and V5-epitope (SAB1306079 ...
-
bioRxiv - Cancer Biology 2023Quote: ... RUVBL1 (Atlas Antibodies, # HPA019947), HSPD1 (Atlas Antibody ...
-
bioRxiv - Cancer Biology 2023Quote: ... COX4I1 (Atlas antibody, #HPA002485), KRT19 (Abcam ...
-
bioRxiv - Cancer Biology 2023Quote: ... MYH10 (Atlas Antibodies, #HPA047541), cytochalasin D (Thermo Fisher ...
-
bioRxiv - Cancer Biology 2023Quote: ... HSPA9 (Atlas Antibody, #HPA000898), COX4I1 (Atlas antibody ...
-
bioRxiv - Cancer Biology 2023Quote: ... RUVBL2 (Atlas Antibodies, #HPA067966), RUVBL1 (Atlas Antibodies ...
-
bioRxiv - Cancer Biology 2023Quote: ... HSPD1 (Atlas Antibody, #HPA050025), HSPA9 (Atlas Antibody ...
-
bioRxiv - Genetics 2023Quote: ... MITF (HPA003259, Atlas Antibodies) 1:100 and tubulin-AF488 (clone DM1A ...
-
bioRxiv - Immunology 2023Quote: ... KLC2 (Atlas Antibodies, HPA040416), CNOT1 (Cell Signaling Technology ...
-
bioRxiv - Cell Biology 2023Quote: ... CEP120 (Atlas Antibodies; HPA028823): 1/500 ...
-
bioRxiv - Neuroscience 2023Quote: ... EMX1 (Atlas Antibodies, HPA006421); LHX9 (Sigma ...
-
bioRxiv - Molecular Biology 2024Quote: ... Anti- NUDT16L1 (Atlas Antibodies) 1:500 ...
-
bioRxiv - Molecular Biology 2023Quote: ... ALKBH5 (Atlas Antibodies, HPA007196), ZFC3H1 (Bethyl laboratories ...
-
bioRxiv - Molecular Biology 2020Quote: ... Rabbit polyclonal antibodies (PABPC1, Atlas Antibodies #HPA045423; p70 S6 kinase α (H-160), Santa Cruz #sc-9027 ...
-
bioRxiv - Cell Biology 2020Quote: ... rabbit anti-PLCE1 antibody diluted at 1:1000 (HPA015597, Atlas Antibodies, Bromma, Sweden); peroxidase-conjugated mouse anti-β-actin antibody diluted at 1:10,000 (clone 2F3 ...
-
bioRxiv - Cell Biology 2021Quote: ... The PVDF membrane was blocked and then incubated with KCNQ1 antibodies (ATLAS ANTIBODIES) overnight at 4°C ...
-
bioRxiv - Cell Biology 2020Quote: ... incubation with the primary antibody (anti-swiprosin-1, Atlas Antibodies, diluted 1:200) for 1h ...
-
bioRxiv - Cancer Biology 2020Quote: ... followed by addition of anti-PIWIL1 antibody (Atlas antibodies, HPA018798, 1:1000 dilution), or anti-PCNA antibody (Servicebio ...
-
bioRxiv - Microbiology 2022Quote: ... Cells were intracellularly stained with a rabbit anti-TMPRSS2 antibody (Atlas antibodies, HPA035787) at 0.3 mg/mL ...
-
bioRxiv - Genetics 2019Quote: ... then incubated with the following antibodies for 1hr: anti-ARMC9 (rabbit, Atlas Antibodies cat# HPA019041 ...
-
bioRxiv - Neuroscience 2022Quote: ... followed by overnight incubation with primary antibodies (CDKL5- 1:1000, #HPA002847, Atlas Antibodies-Sigma Aldrich ...
-
bioRxiv - Immunology 2019Quote: ... The antibodies used in the study include: rabbit anti-human PI31 (Atlas Antibodies, HPA041122), rabbit anti-mouse PI31 (Abcam ...