Labshake search
Citations for Atlas Antibodies AB :
51 - 100 of 367 citations for Sodium Voltage Gated Channel Alpha Subunit 10 SCN10A Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2022Quote: ... Primary antibodies used were the following: DDX5 (Atlas Antibodies, HPA020043, [1:200]) and NeuN (Millipore ...
-
bioRxiv - Cell Biology 2019Quote: ... made by Prestige Antibodies Powered by Atlas Antibodies (Sigma-Aldrich, catalog #: HPA017430). The amino acid sequence of the antigen is MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGS KEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD.
-
bioRxiv - Biophysics 2021Quote: ... Binding of primary antibody (Elys (catalog no. HPA031658, Atlas Antibodies, 1:50), Nup133 (catalog no ...
-
bioRxiv - Cell Biology 2023Quote: ... or in 4% fetal bovine serum for antibodies acquired from ATLAS antibodies for at least 40 minuntes at RT ...
-
bioRxiv - Cell Biology 2023Quote: ... Primary antibodies used included SNX17 rabbit pAb (1:1000, HPA043867, Atlas Antibodies), SNX17 mouse mAb ...
-
bioRxiv - Cell Biology 2023Quote: ... Antibodies against GOLGA1_1 Golgin-97 (cat: HPA044329) were purchased from Atlas Antibodies. Antibodies against LMAN1 ERGIC-53 (cat ...
-
bioRxiv - Cell Biology 2023Quote: ... the membrane was incubated overnight with anti-MRPP1 antibody (Atlas Antibodies, HPA036671) at 1:1000 dilution or anti-GAPDH antibody (Novus Biologicals ...
-
bioRxiv - Molecular Biology 2021Quote: ... ZC3H4 (HPA040934, Atlas Antibodies), HA tag (clone 3f10 ...
-
bioRxiv - Developmental Biology 2019Quote: ... KLF17 (Atlas Antibodies HPA024629), TFCP2L1 (R&D Systems AF5726) ...
-
bioRxiv - Cell Biology 2019Quote: ... MIC27 (Atlas Antibodies, HPA000612), MIC60 (custom-made ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and Tubulin (T6199 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies), PABPN1 (LS-B8482 ...
-
bioRxiv - Cell Biology 2020Quote: ... MURC (HPA021021, Atlas antibodies) and specific myosin heavy chain isotype were stained with MyHC-2a and MyHC-2b conjugated to 594 and 488 fluorophore ...
-
bioRxiv - Immunology 2019Quote: ... and FATP3 (Atlas antibodies) were measured in conjunction with goat anti-rabbit AF488 (Abcam) ...
-
bioRxiv - Cancer Biology 2021Quote: ... NAGK (Atlas Antibodies, HPA035207), and PARP (Cell Signaling 9532).
-
bioRxiv - Cell Biology 2021Quote: ... Treacle (HPA038237, Atlas Antibodies), NBS1 (1D7 ...
-
bioRxiv - Microbiology 2020Quote: ... PAPD5 (Atlas Antibodies, HPA042968) at 1:1000 and ZCCHC14 (Bethyl ...
-
bioRxiv - Cancer Biology 2021Quote: ... HMCES (HPA044968, Atlas Antibodies). The HMCES knockdown stable cell lines (HCC-78 ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670). Alexa Fluor®-488 and Alexa Fluor®-555 (Cell Signaling) ...
-
bioRxiv - Cell Biology 2022Quote: ... ZDHHC5 (Atlas Antibodies, HPA014670), Calnexin (Abcam ...
-
bioRxiv - Cancer Biology 2020Quote: ... NAGK (Atlas Antibodies HPA035207), O-GlcNAc (Abcam 2735) ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-WASH1 (Atlas Antibodies, cat ...
-
bioRxiv - Biochemistry 2021Quote: ... ITIH4 (Atlas Antibodies, HPA003948), MFGE8 (Thermo Scientific ...
-
bioRxiv - Biochemistry 2021Quote: ... CLPTM1L (HPA014791, Atlas Antibodies), UBE2J1 (sc-377002 ...
-
bioRxiv - Cell Biology 2020Quote: ... NPHP4 (Atlas Antibodies, #HPA065526), GFP (Aves Labs Inc ...
-
bioRxiv - Cell Biology 2023Quote: ... MIC19 (Atlas Antibodies, HPA042935), COX3 (Proteintech ...
-
bioRxiv - Molecular Biology 2023Quote: ... GPD1 (HPA044620, Atlas Antibodies).
-
bioRxiv - Molecular Biology 2023Quote: ... BCAP31 (Atlas Antibodies, HPA003906) and V5-epitope (SAB1306079 ...
-
bioRxiv - Cancer Biology 2023Quote: ... RUVBL1 (Atlas Antibodies, # HPA019947), HSPD1 (Atlas Antibody ...
-
bioRxiv - Cancer Biology 2023Quote: ... COX4I1 (Atlas antibody, #HPA002485), KRT19 (Abcam ...
-
bioRxiv - Cancer Biology 2023Quote: ... MYH10 (Atlas Antibodies, #HPA047541), cytochalasin D (Thermo Fisher ...
-
bioRxiv - Cancer Biology 2023Quote: ... HSPA9 (Atlas Antibody, #HPA000898), COX4I1 (Atlas antibody ...
-
bioRxiv - Cancer Biology 2023Quote: ... RUVBL2 (Atlas Antibodies, #HPA067966), RUVBL1 (Atlas Antibodies ...
-
bioRxiv - Cancer Biology 2023Quote: ... HSPD1 (Atlas Antibody, #HPA050025), HSPA9 (Atlas Antibody ...
-
bioRxiv - Genetics 2023Quote: ... MITF (HPA003259, Atlas Antibodies) 1:100 and tubulin-AF488 (clone DM1A ...
-
bioRxiv - Immunology 2023Quote: ... KLC2 (Atlas Antibodies, HPA040416), CNOT1 (Cell Signaling Technology ...
-
bioRxiv - Cell Biology 2023Quote: ... CEP120 (Atlas Antibodies; HPA028823): 1/500 ...
-
bioRxiv - Neuroscience 2023Quote: ... EMX1 (Atlas Antibodies, HPA006421); LHX9 (Sigma ...
-
bioRxiv - Molecular Biology 2024Quote: ... Anti- NUDT16L1 (Atlas Antibodies) 1:500 ...
-
bioRxiv - Molecular Biology 2023Quote: ... ALKBH5 (Atlas Antibodies, HPA007196), ZFC3H1 (Bethyl laboratories ...
-
bioRxiv - Molecular Biology 2020Quote: ... Rabbit polyclonal antibodies (PABPC1, Atlas Antibodies #HPA045423; p70 S6 kinase α (H-160), Santa Cruz #sc-9027 ...
-
bioRxiv - Cell Biology 2020Quote: ... rabbit anti-PLCE1 antibody diluted at 1:1000 (HPA015597, Atlas Antibodies, Bromma, Sweden); peroxidase-conjugated mouse anti-β-actin antibody diluted at 1:10,000 (clone 2F3 ...
-
bioRxiv - Cell Biology 2021Quote: ... The PVDF membrane was blocked and then incubated with KCNQ1 antibodies (ATLAS ANTIBODIES) overnight at 4°C ...
-
bioRxiv - Cell Biology 2020Quote: ... incubation with the primary antibody (anti-swiprosin-1, Atlas Antibodies, diluted 1:200) for 1h ...
-
bioRxiv - Cancer Biology 2020Quote: ... followed by addition of anti-PIWIL1 antibody (Atlas antibodies, HPA018798, 1:1000 dilution), or anti-PCNA antibody (Servicebio ...
-
bioRxiv - Microbiology 2022Quote: ... Cells were intracellularly stained with a rabbit anti-TMPRSS2 antibody (Atlas antibodies, HPA035787) at 0.3 mg/mL ...
-
bioRxiv - Genetics 2019Quote: ... then incubated with the following antibodies for 1hr: anti-ARMC9 (rabbit, Atlas Antibodies cat# HPA019041 ...
-
bioRxiv - Neuroscience 2022Quote: ... followed by overnight incubation with primary antibodies (CDKL5- 1:1000, #HPA002847, Atlas Antibodies-Sigma Aldrich ...
-
bioRxiv - Immunology 2019Quote: ... The antibodies used in the study include: rabbit anti-human PI31 (Atlas Antibodies, HPA041122), rabbit anti-mouse PI31 (Abcam ...
-
bioRxiv - Cell Biology 2021Quote: ... A rabbit Kif9 antibody was used at 1:100 dilution from Atlas Antibodies (HPA022033). Mouse acetylated tubulin antibody was incubated at 1:1000 from Sigma (6-11B-1) ...