Labshake search
Citations for Origene Technologies :
101 - 150 of 449 citations for Recombinant Human ERBB2 protein Fc tagged R PE labeled since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2023Quote: A recombinant hCABS1 overexpression lysate (OEL) produced in Human Embryonic Kidney 293T (HEK293T) cells (OriGene Technologies Inc., Rockville, MD, USA) was used as a positive control in WB ...
-
bioRxiv - Biochemistry 2021Quote: ... transiently co-transfected with pcDNA3.1-FIT2/V5-His and GFP-tagged MARCH6 (BC059190) Mouse Tagged ORF Clone (Origene), were pre-treated with 10 µM MG132 (Cell Signaling Technology ...
-
bioRxiv - Physiology 2024Quote: ... which are Myc-DDK-tagged (OriGene, USA). After 24 hrs ...
-
bioRxiv - Genetics 2022Quote: ... and for WDR60p.Ala911Val mutant cells were transfected with WDR60 Mouse Myc-DDK-tagged tagged ORF Clone (MR217536, Origene, Maryland, USA). After 24 h cells were treated with 10µM monensin and immunofluorescence analysis was done as explained above ...
-
ANGPTL8 R59W variant influences inflammation through modulating NF-κB pathway under TNFα stimulationbioRxiv - Biochemistry 2023Quote: ... Myc tagged pCMV6 vector (OriGene, Rockville, MD, USA) was used as control for the transfection experiments ...
-
bioRxiv - Developmental Biology 2024Quote: ... Lmx1b Mouse Tagged ORF Clone plasmids (ORIGENE, MG226016) were transfected using Lipofectamine LTX Reagent with PLUS Reagent (Invitrogen ...
-
bioRxiv - Cancer Biology 2022Quote: ... and Myc-DDK-tagged PEX19 (OriGene Technologies, RC201756) using Lipofectamine 2000 (Invitrogen ...
-
bioRxiv - Cancer Biology 2020Quote: In vitro immunoprecipitations were prepared using 0.012 μg of bacterially produced and purified recombinant RIOK2 protein (Origene, cat#TP602270) and 0.012 μg of bacterially produced and purified recombinant IMP3 protein (Origene ...
-
bioRxiv - Molecular Biology 2024Quote: Recombinant CYP2A6 (TP322995) from Origene was used to test the in vitro HNEylation of CYP2A6 ...
-
bioRxiv - Genetics 2022Quote: ... were incubated with either 8µg/mL or 16µg/mL of variant (TP607036;MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDA PLEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCSV) or reference (TP607035; MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAA KLGVKRCTDQMSLQKRSLIAEVLVKILKKCSV) SCGB1D2 recombinant protein (Origene Technologies) in a total well volume of 150uL ...
-
bioRxiv - Neuroscience 2024Quote: ... The total GFP amount was estimated through a calibration curve obtained by measuring the fluorescence intensity of the recombinant tGFP Protein (Pontellina plumata, CAT#: TP700079, Origene) at increasing concentrations with a Tecan SPARK (Tecan ...
-
bioRxiv - Cancer Biology 2022Quote: ... DDK-MYC tagged RBFOX2 cDNAs were purchased from Origene in pCMV6-Entry vector (Cat ...
-
bioRxiv - Neuroscience 2023Quote: Plasmids (Myc-tagged TSPO (‘TSPO-Myc’; catalogue # RC220107, OriGene) or a pCMV EV control (catalogue # PS100001 ...
-
bioRxiv - Pathology 2021Quote: ... Additional positive and negative control experiments were performed in which purified recombinant PBX1 and MEIS2 proteins (purchased from Origene, Rockville, MD) were incubated with the same concentrations of each drug and assayed.
-
bioRxiv - Immunology 2024Quote: ... with recombinant TSP-1 (Origene, USA) at a concentration of 100ng/ml ...
-
bioRxiv - Molecular Biology 2024Quote: 1 μM of recombinant CYP2A6 (Origene), approximately 2.83 μg in 45 μL ...
-
bioRxiv - Biochemistry 2024Quote: ... 250 ng recombinant TFEB (OriGene, TP760282) or recombinant ACC2 (Aviva ...
-
bioRxiv - Neuroscience 2021Quote: ... mouse Csde1 ORF clone (Origene, MR210719, NM_144901, Myc-DDK-tagged) was sub-cloned into FUGW vector including its original Myc-DDK-tag using AgeI/EcoRI restriction sites.
-
bioRxiv - Neuroscience 2021Quote: Plasmid encoding myc-tagged mouse MARCKS was purchased from Origene. Plasmid encoding HA-PKCα was a gift from Bernard Weinstein (Addgene plasmid #21232) ...
-
bioRxiv - Cell Biology 2021Quote: ... Myc- and DDK-tagged hemopexin plasmid was purchased from Origene. Glycosylation and cysteine mutations were made with the Quick Change II Site-Directed Mutagenesis kit (Promega) ...
-
bioRxiv - Neuroscience 2021Quote: ... mouse Gpr151 ORF clone (Origene, MR223707, NM_181543, Myc-DDK-tagged) was sub-cloned into FUGW vector including its original Myc-DDK-tag with no any UTRs at AgeI/EcoRI restriction sites ...
-
bioRxiv - Biophysics 2023Quote: ... flag-tagged mTHSD7A construct serving as the PCR template (Origene).
-
bioRxiv - Cancer Biology 2023Quote: ... and HA-tagged mouse VHL ORF Clone (Origene; Cat #MR201630) as templates to amplify human and mouse VHL ...
-
bioRxiv - Cell Biology 2023Quote: FLAG-tagged wild type AMOTL2 (NM_016201) was obtained from Origene. Codon-optimized sequences encoding truncated ...
-
bioRxiv - Genomics 2023Quote: c-myc-tagged Ephb4 cDNA in pCMV6 was from Origene. Single K650N ...
-
bioRxiv - Neuroscience 2024Quote: ... The FLAG-tagged Zbtb7a construct was purchased from Origene (RC222759).
-
bioRxiv - Cell Biology 2024Quote: Myc-tagged murine NHSL2 (NM_001163610) was purchased from Origene (MR223518) and was used to clone full length murine NHSL2 ...
-
bioRxiv - Cell Biology 2021Quote: ... Purified human AXIN1-MYC/DDK (TP308349) and TPX2-MYC/DDK (TP305821) proteins were obtained from OriGene Technologies (Rockville ...
-
bioRxiv - Cancer Biology 2020Quote: ... The Myc-DDK-tagged ORF clone of MAFG (RC221486, OriGene USA) was a gift from I ...
-
bioRxiv - Microbiology 2024Quote: Myc-tagged FOS (pCMV6-FOS) expressing vector was purchased from OriGene. The pBAH4 plasmid with point mutations in the ORF57 BS in FOS cDNA was generated by overlapping PCR using a set of primers with mutated BS (oBAH138 and oBAH139 ...
-
bioRxiv - Cancer Biology 2024Quote: ... The Myc-DDK-tagged ORF clone of MAFG (OriGene, Cat. # RC221486) was cloned into pLEGB to replace GFP and create pLEB-MAFG ...
-
bioRxiv - Microbiology 2024Quote: 5 µg of recombinant LC3C (Origene, TP761768), recombinant LC3B (Sino Biological ...
-
bioRxiv - Cell Biology 2024Quote: ... Recombinant myc-IPMK was purchased from Origene, (Cat # ...
-
bioRxiv - Genomics 2024Quote: ... R: CCAGGAACTCATACCCACGCTC (Origene, USA). Primers were obtained from previous literature or previously validated in our lab ...
-
bioRxiv - Cancer Biology 2020Quote: ... were transiently transfected with pCMV6 CMTM6 (Myc-DDK-tagged) (Origene, Cat #RC201061) using the ViaFect transfection reagent (Promega Cat# E4982) ...
-
bioRxiv - Cancer Biology 2021Quote: ... by stable transfection with Myc-tagged PDK1 overexpressing plasmid (OriGene, Rockville, MD).
-
bioRxiv - Cancer Biology 2022Quote: ... were transiently transfected with pCMV6 CMTM6 (Myc-DDK-tagged) (Origene, Cat# RC201061) using the ViaFect transfection reagent (Promega Cat# E4982) ...
-
bioRxiv - Neuroscience 2021Quote: Myc-flag-tagged full-length Cdh8 was purchased from Origene (plasmid #MR218916). Cdh8 was expressed under the CMV promoter in the pCMV6 vector ...
-
bioRxiv - Biochemistry 2022Quote: ... Cells were transfected with Myc-DDK-tagged Rho-GDI1 (ARHGDIA) (MR202112 OriGene) using Lipofectamine 3000 (L3000015 Invitrogen ...
-
bioRxiv - Cell Biology 2020Quote: ... A Myc-Flag-tagged mouse Activin expression plasmid was purchased from Origene Technologies (MR225191) ...
-
bioRxiv - Neuroscience 2023Quote: ... KCNK3 (Myc-DDK-tagged) (TASK-1) (NM_002246.3) was purchased from OriGene (RC215155) and cloned into IRES2 vector using BglII/XhoI sites ...
-
bioRxiv - Genetics 2023Quote: ... The Myc-DDK-tagged-CBX1 expression vector was purchased from Origene (RC205672). CBX1 mutations were introduced using the Q5 Site-Directed Mutagenesis Kit (New England Biolabs Inc. ...
-
bioRxiv - Neuroscience 2024Quote: The plasmid pCMV6 TRIM47 (Myc-DDK-tagged) was purchased from Origene (RC218521). It contains the full sequence of human TRIM47 (NM_033452 ...
-
bioRxiv - Cell Biology 2024Quote: ... and GFP-tagged wild-type gigaxonin construct (pCMV6-AC-GFP vector; Origene) was conducted using XL1-blue supercompetent cells from Aligent Technologies ...
-
bioRxiv - Cancer Biology 2024Quote: To establish the stable overexpression of SOX10 (Myc-DDK tagged; OriGene, #RC203545L3V) in A375 and A2058 cell lines ...
-
bioRxiv - Immunology 2024Quote: Recombinant AMPK γ1 chain (AMPKɣ; AR51158PU-S, OriGene) and Sestrin 2 (GWB-66FAFC-50UG ...
-
bioRxiv - Microbiology 2020Quote: ... The pCMV6 construct coding for myc-FLAG tagged GNG5 was purchased from OriGene.
-
bioRxiv - Microbiology 2021Quote: ... the myc-DDK-tagged-RORC2 cDNA was PCR-amplified from plasmid RC212239 (Origene) and cloned into the MLV-based retroviral vector pMIG Blasti (gift of Jeremy Luban ...
-
bioRxiv - Molecular Biology 2020Quote: ... Alkbh1 Rat Tagged ORF Clone Lentiviral Particles were purchased from Origene (Cat# RR214755L2V). Lipofectamine RNAimax was purchased from Thermo Fischer (Cat# 13778150) ...
-
bioRxiv - Microbiology 2020Quote: Vectors expressing C-terminally FLAG-tagged ATP6V0C and ATP6V0C” were obtained from OriGene Technologies Inc ...