Labshake search
Citations for Lampire Biological Laboratories :
1 - 50 of 61 citations since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2024Quote: ... 0.75% guinea pig red blood cells (GPRBCs) (Lampire Biologicals, Pipersville, PA, USA) for H3 subtype viruses in the presence of 20nM Oseltamivir ...
-
bioRxiv - Bioengineering 2024Quote: ... or BSA (LAMPIRE Biological laboratories, cat no. 7500804) in PBS ...
-
bioRxiv - Animal Behavior and Cognition 2024Quote: ... Cages of adults were fed weekly using an artificial feeder (D.E. Lillie Glassblowers, Atlanta, Georgia; 2.5 cm internal diameter) with heparinized bovine blood (Lampire Biological Laboratories, Pipersville, PA, USA) heated at 37 °C using a circulating water-bath ...
-
bioRxiv - Microbiology 2023Quote: ... anti-MCF (produced with purified MCF protein by Lampire Biological Laboratories, Pipersville PA), anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories ...
-
bioRxiv - Microbiology 2023Quote: ... anti-ACD (produced with purified ACD protein by Lampire Biological Laboratories, Pipersville PA), anti-ARF1 (Novus Biologicals NBP1-97935) ...
-
bioRxiv - Immunology 2023Quote: ... virus strain for 30min at room temperature (RT) prior to addition of 50μL of 1% chicken red blood cells (cRBCs) (Lampire Biological Laboratories) in 1X PBS ...
-
bioRxiv - Bioengineering 2023Quote: ... Sections were blocked in PBS with 5% normal goat serum (NGS; Lampire Biological, Pipersville, PA), 1% hydrogen peroxide ...
-
bioRxiv - Microbiology 2023Quote: ... supplemented with 10% defibrinated horse blood (DHB; Lampire Biological Laboratories ...
-
bioRxiv - Bioengineering 2023Quote: Citrated bovine calf whole blood was acquired through venipuncture (Lampire Biological Laboratories, PA) from a single donor animal ...
-
bioRxiv - Cancer Biology 2023Quote: ... Cells were blocked with 100 ug/mL mouse IgG (Lampire Biological Laboratories) or Human TruStain FcX (BioLegend) ...
-
bioRxiv - Immunology 2023Quote: Rabbit polyclonal antibodies against human or murine IFNε proteins were generated by using peptides derived from IFNε protein sequences (Lampire Biological Laboratories (Pipersville, PA). The specificity of antibodies was determined by western blot analysis ...
-
bioRxiv - Neuroscience 2023Quote: ... An artificial feeder (D.E. Lillie Glassblowers, Atlanta, GA, USA; 2.5 cm internal diameter) filled with heparinized bovine blood (Lampire Biological Laboratories, Pipersville, PA, USA) placed on the top of the cage and heated at 37°C using a water-bath circulation was used to feed mosquitoes weekly.
-
bioRxiv - Bioengineering 2023Quote: Whole blood clots were prepared from bovine blood collected with CPDA-1 anticoagulant at 14% volume anticoagulant/total volume and derived from a single donor animal (Lampire Biological Laboratories, PA,USA) (Sugerman et al. ...
-
bioRxiv - Biochemistry 2023Quote: ... The antibody against Xenopus laevis Nap1 was generated by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Biochemistry 2023Quote: ... The antibodies against Xenopus laevis Npm2 and Npm2 core domain were generated by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Neuroscience 2023Quote: ... after which 50 µl of PBS containing 0.04% BSA (from LAMPIRE Biological Laboratories Cell Culture Grade 35% BSA Liquid (Fisher Scientific Cat ...
-
bioRxiv - Neuroscience 2023Quote: ... blocked in PBS/0.3T containing 5% normal goat serum (Lampire Biological Laboratories, Pipersville, PA) for 30 min at RT ...
-
bioRxiv - Bioengineering 2023Quote: ... One tube (left side in Fig. S5a) was filled with defibrinated bovine blood (Lampire biological laboratories, Pipersville, PA, USA) while circulated using a peristatic pump (model 3386 ...
-
bioRxiv - Microbiology 2023Quote: ... and 10% normal goat serum (Lampire Biological Laboratories, Pipersville, PA) for 10 minutes before staining with a primary monoclonal antibody that reacts with multiple flaviviruses (Flavivirus treatment antigen antibody D1-4G2-4-15 ...
-
bioRxiv - Biophysics 2022Quote: Pooled bovine SF (Lampire Biological Laboratories, 8600853) was used to prepare working aliquots ...
-
bioRxiv - Immunology 2022Quote: ... and then 0.5% chicken red blood cells (Lampire Biological Laboratories) were added to determine HAI titers ...
-
bioRxiv - Developmental Biology 2022Quote: ... + 0.22 g glucose (MilliporeSigma, G7528) + 1.23 g sodium bicarbonate (MilliporeSigma, S5761) + 10 g fatty-acid free bovine serum albumin (FAF-BSA) (Lampire Biological Laboratories, 7500812) + 10 μL Insulin-Transferrin-Selenium-Ethanolamine (ITS-X ...
-
bioRxiv - Animal Behavior and Cognition 2022Quote: ... Cages of adults were fed weekly using an artificial feeder (D.E. Lillie Glassblowers, Atlanta, Georgia; 2.5 cm internal diameter) with heparinized bovine blood (Lampire Biological Laboratories, Pipersville, PA, USA) heated at 37°C using a circulating water-bath ...
-
bioRxiv - Animal Behavior and Cognition 2022Quote: ... The warmed feeder was filled with ∼ 5 ml of heparinized bovine whole blood (Lampire Biological Laboratories, Pipersville, PA, USA) fifteen minutes prior to the beginning of the experiment to allow the blood to heat up ...
-
bioRxiv - Cell Biology 2022Quote: ... and BSA (Lampire Biological Laboratories, 7500804) using the following concentrations:
-
bioRxiv - Microbiology 2022Quote: ... supplemented with 10% defibrinated horse blood (DHB; Lampire Biological Laboratories). For Fusobacterium culture FAA+10% DHB plates included josamycin (3 μg/mL) ...
-
bioRxiv - Plant Biology 2022Quote: ... Fresh rat serum (Lampire Biological Laboratories, Pipersville, PA, USA) was shipped on wet ice ...
-
bioRxiv - Molecular Biology 2022Quote: Custom α-Sas6T antiserum was generated by rabbit immunization with purified recombinant Sas6T protein (Lampire Biological Laboratories). The resulting antiserum was used for western blotting and cell staining ...
-
bioRxiv - Physiology 2022Quote: Glossina morsitans morsitans flies were maintained on defibrinated bovine blood (Lampire Biologicals, Pipersville, PA, USA) at 25°C and 50-60% RH using an artificial membrane feeding system (Moloo ...
-
bioRxiv - Bioengineering 2022Quote: ... anticoagulated bovine blood (Lampire Biological Laboratories, Pipersville, PA, USA) containing acid citrate dextrose (ACD ...
-
bioRxiv - Immunology 2021Quote: ... Turkey erythrocytes (Lampire Biological Laboratories) were added (12.5 μl of a 2% [vol/vol] solution) ...
-
bioRxiv - Immunology 2021Quote: ... Rabbit anti-SLC37A2 polyclonal antibody was made against the peptide CTPPRHHDDPEKEQDNPEDPVNSPYSSRES (LAMPIRE Biological Lab Inc.) and used at a dilution of 1:500 24.
-
bioRxiv - Genetics 2021Quote: ... adults were provided commercially available bovine blood treated with sodium citrate (Lampire Biological Laboratories). Egg rafts for microinjection were collected after 1-3 opportunities for blood-feeding ...
-
bioRxiv - Evolutionary Biology 2021Quote: ... Goose blood (Na-heparinated, obtained from Lampire Biological) sweetened with 50% sucrose solution (8:1 ratio ...
-
bioRxiv - Bioengineering 2021Quote: Young (1-2 weeks old) bovine knee joints were obtained from Vendors (Lampire biological laboratories), and cartilage explants were harvested from the trochlear groove using biopsy punch and cultured with chemically defined medium (DMEM ...
-
bioRxiv - Bioengineering 2021Quote: Porcine whole blood was obtained from a commercial source (Lampire Biological Laboratories, Pipersville, PA) in 1-liter quantities ...
-
bioRxiv - Immunology 2021Quote: ... Hemagglutination activity of each preparation of VLP was determined by serially diluting volumes of VLPs and adding equal volume 0.8% turkey red blood cells (RBCs) (Lampire Biologicals, Pipersville, PA, USA) suspended in PBS to a V-bottom 96-well plate with a 30 min incubation at room temperature (RT) ...
-
bioRxiv - Bioengineering 2021Quote: ... Anti-Atsttrin antibody was supplied by Lampire Biological Laboratories (Pipersville ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... 0.8% erythrocytes in PBS were added (Lampire Biologicals, Piperville, PA). For H1N1 ...
-
bioRxiv - Physiology 2021Quote: ... and 1% normal goat serum (Lampire Biological Laboratories 7332500; Pipersville, USA) in PBS and incubated for six hours on a rotator ...
-
bioRxiv - Microbiology 2021Quote: ... VP35 and VP30 were produced by Lampire Biological Laboratories using their standard protocol ...
-
bioRxiv - Animal Behavior and Cognition 2021Quote: ... Tissue was first treated with 0.6 % H2O2 for 30 minutes at room temperature and then incubated with 5% Normal Goat Serum (NGS) (Lampire Biological Laboratories) in Tris-Buffered Saline Tween at room temperature for 30 min to decrease probability of non-specific antibody binding ...
-
bioRxiv - Physiology 2021Quote: ... mosquitoes were fed through a membrane on rooster blood treated with the anticoagulant sodium citrate (Lampire Biological Laboratories ...
-
An egg-derived sulfated N-Acetyllactosamine glycan is an antigenic decoy of influenza virus vaccinesbioRxiv - Immunology 2021Quote: ... 50 μl of 0.5% turkey red blood cells (Lampire Biological) were added to each well and incubated for 45 minutes at room temperature ...
-
bioRxiv - Bioengineering 2020Quote: Bovine blood was purchased from Lampire Biologicals Laboratories (Bovine 7200807-1L ...
-
bioRxiv - Biochemistry 2020Quote: ... supplemented with 5 % (v/v) sheep blood (Lampire Biological, Pipersville PA) or MH agar plates containing 1.5 % (m/v ...
-
bioRxiv - Microbiology 2020Quote: ... composed of Clostridium difficile Agar Base (OxoiD) with 7% v/v of Defibrinated Horse Blood (Lampire Biological Laboratories), supplemented with 32 mg/L Moxalactam (Santa Cruz Biotechnology ...
-
bioRxiv - Immunology 2020Quote: ... Immune sera and mAbs were serially diluted and incubated with reporter viruses and then incubated with 0.5% turkey red blood cells (Lampire Biological Laboratories) for 30 min at room temperature ...
-
bioRxiv - Pharmacology and Toxicology 2020Quote: ... pertussis strain was grown on Bordet-Gengou (BG) agar plates supplemented with defibrinated sheep blood (10%, Lampire Biological Products ...
-
bioRxiv - Neuroscience 2020Quote: ... and then blocked in PBS/0.3T containing 5% normal goat serum (Lampire Biological Laboratories, Pipersville, PA) for 30min at RT ...