Labshake search
Citations for Thermo Fisher :
401 - 450 of 10000+ citations for Mouse Leucine Rich Pentatricopeptide Repeat Containing LRPPRC ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2023Quote: HIF-1α was evaluated using a HIF-1 Alpha ELISA Kit (Invitrogen™). Procedure steps were followed according to the manufacturer’s instructions and results were monitored at 450 nm ...
-
bioRxiv - Immunology 2024Quote: ... the supernatant was collected and analyzed with ELISA kits for IFNγ (Life Technologies) and TNFα (Proteintech ...
-
bioRxiv - Cancer Biology 2019Quote: ... ELISA plates were developed using the Turbo TMB-ELISA (Fisher Scientific) and the reaction was stopped by addition of 2N H2SO4 ...
-
bioRxiv - Biochemistry 2023Quote: ... All ELISA experiments were performed on 96-well ELISA plates (Nunc) coated overnight with 2 µg/mL neutravidin and blocked for at least two hours with selection buffer ...
-
bioRxiv - Immunology 2020Quote: ... IgM, and IgY were measured using an ELISA kit (Shanghai Yeyuan Biotechnology Company, China) and with an ELISA Reader (Thermo Fisher, Varioskan Flash, USA) following the manufacturers’ instructions ...
-
bioRxiv - Microbiology 2021Quote: Total RNA was extracted from mycelia from three biological repeats using the TRIzol (Invitrogen, USA) reagent according to the manufacturer’s instruction ...
-
bioRxiv - Neuroscience 2023Quote: ... and by Repeat-Primed PCR using 2X Phusion Flash High-Fidelity PCR Mastermix (Thermo Fisher). End-point PCR was achieved by amplifying across the repeat region where the presence of a single band at the expected size indicated a non-expanded Wild-Type locus ...
-
bioRxiv - Neuroscience 2021Quote: ... ISF Aβ42 in the 14 samples for each mouse was measured by ELISA (Invitrogen, KHB3441, 1:4). To determine Aβ42 half-life (Cirrito et al. ...
-
bioRxiv - Immunology 2020Quote: ISG15 ELISA was performed by coating plate with diluted rabbit anti mouse ISG15 (PA5-17461; Thermo Scientific) 1:1000 in PBS overnight ...
-
bioRxiv - Biophysics 2024Quote: The DNA sequence of parallel Leucine zipper pair GCN4_v4 (LZ, IASRMKQLEDKVEELLSKNYHLENEVARLKKLVGECEGL) and GCN4_v4 with SNAP tag (LZ-SNAP) were customised by GeneArt (Invitrogen) into pMA plasmids ...
-
bioRxiv - Cell Biology 2022Quote: Rich medium (Yeast Peptone Dextrose, YPD) consisted of 1% yeast extract (Thermo Fisher Scientific, product number 212750), 2% peptone (Thermo Fisher Scientific ...
-
bioRxiv - Molecular Biology 2024Quote: Microscope samples were prepared by sandwiching agarose gel pads (rich, defined media with 2 % Invitrogen UltraPure agarose) of approximately 100 µL between microscope slides and acid-cleaned #1.5H coverslips (Marienfeld) ...
-
bioRxiv - Immunology 2019Quote: The concentration of sPD-1 and sTim-3 was measured in thawed plasma samples by enzyme linked immunosorbent assay (ELISA) using Human PD-1 (PDCD1) ELISA kit [EHPDCD1] (Thermo Fisher Scientific, Waltham, MA USA) and Quantikine ELISA Human TIM-3 Immunoassay kit [DTIM30] (R&D Systems ...
-
bioRxiv - Immunology 2023Quote: ... ELISAs were developed using 1-Step Ultra TMB ELISA substrate (Life Technologies), with the reaction being terminated with 0.5M H2SO4 ...
-
bioRxiv - Immunology 2023Quote: ... ELISAs were developed using 1-Step-Ultra TMB ELISA substrate (Life Technologies), terminating the reaction with 0.5 M H2SO4 ...
-
bioRxiv - Immunology 2021Quote: MaxiSorp ELISA plates (Nunc) were coated with whole-cell suspensions at OD 0.1 of N ...
-
bioRxiv - Immunology 2019Quote: ... 96 ELISA plate (Nunc MaxiSorp™ flat-bottom ...
-
bioRxiv - Immunology 2019Quote: ... 96 ELISA plates (Nunc MaxiSorp™ flat-bottom ...
-
bioRxiv - Immunology 2022Quote: MaxiSorp ELISA plates (Invitrogen), were coated with purified recombinant SARS-COV-2 RBD domain (BEI ...
-
bioRxiv - Biochemistry 2019Quote: ... The ELISA plates (Nunc-Immuno Plate ...
-
bioRxiv - Cell Biology 2021Quote: ... the ELISA plate (Nunc-Immuno™ plates ...
-
bioRxiv - Cancer Biology 2022Quote: ... ELISA plates (Thermo Fisher) were coated overnight at 4°C with 1 μg/ml anti-CD19 MAb FMC63 (Novus ...
-
bioRxiv - Microbiology 2021Quote: ... MaxiSORP ELISA plates (Nunc) were pre-coated with spike protein (2 μg/mL ...
-
bioRxiv - Immunology 2020Quote: ... MaxiSorp ELISA plates (Nunc) were coated with 2 μg/ml of SARS-CoV-2 Spike overlapping peptide pools corresponding to whole S1 or S2 proteins (JPT ...
-
bioRxiv - Immunology 2021Quote: ... Maxisorp ELISA plates (Nunc) were coated with 50ng/well of recombinant S1 spike protein of SARS-CoV-2 (Acro ...
-
bioRxiv - Immunology 2021Quote: ... and the ELISA (Invitrogen) was carried following the manufacturer protocol.
-
bioRxiv - Immunology 2020Quote: ... and corticosteroids ELISA (Thermofisher) kit following manufacturers’ instruction ...
-
bioRxiv - Immunology 2020Quote: ... MaxiSORP ELISA plates (Nunc) were pre-coated with recombinant luciferase (0.4μg/ml ...
-
bioRxiv - Immunology 2020Quote: ... Maxisorp ELISA plates (Nunc) were coated overnight with anti-IgG1 or anti-IgG4 (2 µg/ml clones MH161-1 ...
-
bioRxiv - Microbiology 2022Quote: ... Immulon IV ELISA (Nunc) plates were coated with 10 μg/mL of fecal antigen in Coat Buffer (0.05M Na2CO3 ...
-
bioRxiv - Immunology 2022Quote: ... ELISA plates (Nunc Maxisorp) were coated with NP20-BSA (Biosearch Technologies ...
-
bioRxiv - Microbiology 2023Quote: ... ELISA plates (MaxiSorp, ThermoFisher) were coated with respective antigens at concentration of 0.1μg/well ...
-
bioRxiv - Bioengineering 2020Quote: Protein concentrations of TNF-α (TNF alpha Equine Uncoated ELISA Kit, ESS0017; Thermo Fisher) and CCL2 (Equine CCL2 (MCP-1 ...
-
bioRxiv - Cancer Biology 2020Quote: ... and TNF-α levels were measured using ELISA kits (ThermoFisher Scientific, Waltham, MA, USA), with sensitivities of <3 pg/mL ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... The ELISA was performed using Human IL-1ẞ high sensitivity kit sold by Invitrogen. The sample for our ELISA consisted of cell culture media (referred to as sample hereafter ...
-
bioRxiv - Neuroscience 2020Quote: ELISA kits were used to measure protein levels of IL-1α (BMS627, Thermofisher Scientific), TNF-α (BMS607-3 ...
-
bioRxiv - Molecular Biology 2022Quote: ... corrected for the amount of total ERK using ERK1/2 (Total) ELISA Kit (Invitrogen) to measure ERK levels.
-
bioRxiv - Neuroscience 2022Quote: ... CORT was measured using the Corticosterone Competitive ELISA kit (Thermo Fisher, #EIACORT, Waltham, MA) following manufacturer’s instructions for small volume blood plasma ...
-
bioRxiv - Immunology 2022Quote: IFNγ in supernatant was measured using Human IFNγ ELISA Kit (Invitrogen, 88-7316-88) according to the manufacturer’s protocol ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... while IL-8 production was evaluated using human IL-8 ELISA kit (Thermo Scientific), with assay range of 2-250 pg/mL.
-
bioRxiv - Immunology 2020Quote: IL-8 secretion was measured using an ELISA kit (Life Technologies; 88-8086-88). Cell-free supernatant was harvested and stored at −20°C until assayed by ELISA ...
-
bioRxiv - Neuroscience 2021Quote: ... and in duplicates for plasma samples using ELISA kits (all from Invitrogen, CA, USA) for human Amyloid beta 40 (#KHB3481) ...
-
bioRxiv - Cell Biology 2022Quote: ... and IL-17A Human Uncoated ELISA Kit (all Thermo Fisher Scientific, Waltham, MA, USA), respectively ...
-
Alpha-1-antitrypsin binds to the glucocorticoid receptor with biological significance in macrophagesbioRxiv - Immunology 2022Quote: ... and the human angiopoietin-like 4 protein (ANGPTL4) ELISA Kit were purchased from Invitrogen-ThermoFisher Scientific (Carlsbad ...
-
bioRxiv - Microbiology 2023Quote: ... The total IgA concentrations in BALFs were determined by a commercial ELISA kit (Invitrogen) using the same procedures.
-
bioRxiv - Bioengineering 2023Quote: ... The concentrations of 2’3’-cGAMP was measured using 2’3’-cyclic cGAMP ELISA kit (Invitrogen) following the manufacturer’s instruction.
-
bioRxiv - Bioengineering 2023Quote: ... Undiluted sample buffer was assayed for ghrelin content using ghrelin human ELISA kit (ThermoFisher) according to manufacturer specifications.
-
bioRxiv - Bioengineering 2023Quote: ... and the resulting supernatant was assayed with human albumin ELISA kit (EHLAB, ThermoFisher Scientific) according to the manufacturer’s instruction ...
-
bioRxiv - Immunology 2024Quote: The concentrations of cytokines in culture supernatants were quantified using ELISA Kits (Invitrogen, Biolegend). The ELISA procedure was carried out strictly following the manufacturer’s instructions ...
-
bioRxiv - Bioengineering 2024Quote: ... STAT5 alpha/beta (Phospho) [pY694/pY699] Human InstantOne™ ELISA Kit (ThermoFisher, MA, USA), anti-mouse CD3 antibody (Proteintech ...