Labshake search
Citations for Thermo Fisher :
551 - 600 of 10000+ citations for Human High Sensitive Leucine Rich Alpha 2 Glycoprotein 1 LRG1 CLIA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2022Quote: RNA from Caco-2 cells was used as the template in reverse transcription reactions using the High-Capacity cDNA Reverse Transcription Kit (ThermoFisher 4368814) following the manufacturer’s protocol ...
-
bioRxiv - Physiology 2023Quote: ... 2 µg of total RNA was used to generate the cDNA using the High-Capacity cDNA Reverse Transcription Kit (ThermoFisher Scientific). The reaction was run in QuantStudio 6 Real-Time PCR Systems using 0.2 μl of cDNA in a 15 μl reaction according to the manufacturer’s instruction in triplicate that measures real-time SYBR green fluorescence ...
-
bioRxiv - Neuroscience 2023Quote: ... Eluted peptides were lyophilized and reconstituted in 300 µL 0.2% TFA for fractionation using the Pierce High pH Reversed-Phase Peptide Fractionation Kit following the instructions provided by Thermo Fisher Scientific for TMT-labelled samples ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... 2 µg RNA samples were reverse-transcribed using the High-Capacity cDNA Reverse Transcription Kit (Applied Biosystems, Foster City, CA, USA). Additional file 1 presents the SYBR Green assay primers ...
-
bioRxiv - Biochemistry 2019Quote: Human embryonic kidney 293 (HEK293) cells were grown in high glucose DMEM (Invitrogen, Carlsbad, CA) supplemented with 10% fetal bovine serum (Sigma ...
-
bioRxiv - Neuroscience 2024Quote: Human Embryonic Kidney 293T (HEK) cells (ATCC) were maintained in high glucose DMEM media (Gibco). Media was supplemented with 10% FBS (Millipore Sigma ...
-
bioRxiv - Developmental Biology 2023Quote: ... The fragment size of the library was assessed using the Agilent Bioanalyzer 2100 with the High Sensitivity DNA kit and was subsequently measured for the concentration by the High Sensitivity QuBit kit (Invitrogen, Q33230). Diluted libraries (4 nM ...
-
bioRxiv - Immunology 2022Quote: ... splenocytes were isolated and stained with 1 µM MitoSOX Red (superoxide sensitive mitochondrial-localized probe, Thermo Fisher Scientific #M36008, Waltham, MA, USA) and cell type discriminating fluorescent antibodies CD19 APC-Cy7 ...
-
bioRxiv - Neuroscience 2020Quote: ... the wells were loaded with a calcium-sensitive fluorophore (Fluo4-AM, Thermo Fisher Scientific), after which cells were investigated for ligand-induced receptor activation using a FLUOstar Omega plate reader (BMG Labtech ...
-
bioRxiv - Bioengineering 2020Quote: ... The stained proteins were detected by applying ultra-sensitive enhanced chemiluminescent substrate (ThermoFisher Scientific) to the membranes for 1 minute and immediately imaged using the GBox Chemi XX6 Imager.
-
bioRxiv - Immunology 2019Quote: ... The Ca2+-sensitive dye Fluo-4AM was procured from Molecular Probes (Eugene, OR, USA). Calcium chelating agents BAPTA-AM and EGTA were procured from Sigma (St Louis ...
-
bioRxiv - Neuroscience 2023Quote: We developed a sensitive assay that uses the fluorescein arsenical dye FlAsH-EDT2 (Invitrogen TC-FlAsH™ in-cell tetracysteine tag detection kit ...
-
bioRxiv - Physiology 2022Quote: ... UUT explants were loaded with the membrane voltage sensitive dye di-4-ANEPPS (Invitrogen) that exhibits depolarizing voltage dependent shifts in green emission (increased intensity ...
-
bioRxiv - Cell Biology 2023Quote: ... or for more sensitive detection SuperSignal™ West Pico PLUS Chemiluminescent Substrate (Thermo Scientific. All uncropped blots are shown in Figures S8 and S9 ...
-
bioRxiv - Microbiology 2020Quote: ... with a Reverse Transcriptase kit (High-Capacity cDNA RT Kit, Applied Biosystems). Per qPCR reaction ...
-
bioRxiv - Neuroscience 2020Quote: ... goat anti-human (ThermoFisher, 1:1000). Hoechst staining (ThermoFisher ...
-
bioRxiv - Genomics 2022Quote: ... or human cot-1 (15279011, ThermoFisher), and 0.6 μl of 100 μM TIME-Seq hybridization blocking primers (IDT) ...
-
bioRxiv - Microbiology 2022Quote: ... 1:2,000 goat anti-human (Invitrogen), 1:1,000 goat anti-mouse (Invitrogen ...
-
bioRxiv - Neuroscience 2019Quote: ... samples were incubated in Alexa594-alpha-bungarotoxin (Invitrogen, B-13423, 50μg/ml, 1:500 in PBS). Tissue was washed 3x in PBS and mounted on a slide with Vectashield mounting media ...
-
bioRxiv - Cell Biology 2023Quote: ... alpha-MEM supplemented with 10% Fetal Bovine Serum (FBS) and 1% penicillin/streptomycin (p./s.) (Gibco). All cultures were maintained in a 37□ incubator with 5% CO2.
-
bioRxiv - Immunology 2021Quote: ... spike glycoproteins were produced in Expi293F cells grown in suspension using Expi293 expression medium (Life Technologies) at 37°C in a humidified 8% CO2 incubator rotating at 130 rpm ...
-
bioRxiv - Immunology 2021Quote: ... Proliferation was triggered by the stimulation with Dynabeads Human T-Activator CD3/CD28 (ratio 1:2, Thermo Fisher Scientific). The arginase inhibitor OAT-1746 (1500 nM) ...
-
Alpha-1-antitrypsin binds to the glucocorticoid receptor with biological significance in macrophagesbioRxiv - Immunology 2022Quote: Human THP-1 cells were cultured in RPMI-1640 medium containing 2 mM L-glutamine (Gibco; Grand Island, NY), 10% FBS ...
-
bioRxiv - Molecular Biology 2023Quote: ... Human β-arrestin 2 (residues 1-393, with I386A, V387A, and F388A mutations) was cloned into pBiT2.1 vector (Invitrogen) with the SmBiT at its N-terminus ...
-
bioRxiv - Immunology 2021Quote: ... Anti-CD8-alpha (53-6.7) was from Invitrogen. Anti-CD11c (N418) ...
-
Reconstitution of prospermatogonial specification in vitro from human induced pluripotent stem cellsbioRxiv - Developmental Biology 2020Quote: ... in Minimum Essential Medium alpha (α-MEM) (Invitrogen) containing 10% KSR (Gibco) ...
-
bioRxiv - Microbiology 2020Quote: ... and anti-alpha-tubulin (MA1-8007, Thermo Scientific diluted 1:300 to 1:500 ...
-
bioRxiv - Developmental Biology 2021Quote: ... and cultured in alpha-MEM (Life Technologies, 12571063) with 0.15 mM ascorbic acid (Sigma-Aldrich ...
-
bioRxiv - Bioengineering 2020Quote: ... 20 % MEM-alpha (12571063; Thermo Fisher Scientific, USA), 20 % DMEM/F12 (10565018 ...
-
bioRxiv - Cancer Biology 2020Quote: ... Cells were resuspended in 60µL MEM alpha (Gibco) before transplantation and monitored using micro CT as previously described(Zheng et al. ...
-
bioRxiv - Immunology 2022Quote: ... cultured in MEM alpha (ThermoFisher Scientific Gibco 12561056) with 10% Fetal bovine serum (R&D systems S11550 ...
-
bioRxiv - Immunology 2022Quote: ... cultured in MEM alpha (ThermoFisher Scientific Gibco 12561056) with 10% Fetal bovine serum (R&D systems S11550 ...
-
bioRxiv - Molecular Biology 2020Quote: ... TNF-alpha was purchased from Gibco (Life technologies). Cdk inhibitor (CGP 60474 ...
-
bioRxiv - Immunology 2019Quote: ... Mouse TNF alpha Uncoated ELISA (Invitrogen, #88-7324); IL-1 alpha Mouse Uncoated ELISA Kit (ThermoFisher #88-501988) ...
-
bioRxiv - Cell Biology 2019Quote: ... HEP3B cells were cultured in alpha-MEM (Gibco) supplemented with 2mM L-glutamine (Gibco) ...
-
bioRxiv - Pharmacology and Toxicology 2021Quote: ... and TNF-alpha were purchased from Thermo Fisher Scientific.
-
bioRxiv - Genomics 2020Quote: ... and cells were cultured in MEM-alpha (Invitrogen) with 10% FBS (Sigma ...
-
bioRxiv - Biophysics 2021Quote: ... mouse anti-alpha tubulin (62204, Thermo Fisher Scientific), rabbit anti-detyrosinated tubulin (ab48389 ...
-
bioRxiv - Immunology 2021Quote: ... was obtained from American Type Culture Collection (ATCC) and cultured in MEM-alpha (Life Technologies) supplemented with 10% fetal bovine serum (FBS) ...
-
bioRxiv - Cell Biology 2022Quote: ... and anti-alpha-Smooth Muscle Actin (Thermo Fisher Scientific ...
-
bioRxiv - Cancer Biology 2023Quote: ... DMEM or alpha-MEM (all Thermo Fisher Scientific) supplemented with 10-20% fetal bovine serum (FBS ...
-
bioRxiv - Biophysics 2024Quote: The DNA sequence of parallel Leucine zipper pair GCN4_v4 (LZ, IASRMKQLEDKVEELLSKNYHLENEVARLKKLVGECEGL) and GCN4_v4 with SNAP tag (LZ-SNAP) were customised by GeneArt (Invitrogen) into pMA plasmids ...
-
bioRxiv - Physiology 2022Quote: ... Inflammatory OCLs were differentiated by seeding a total of 2×104 CD11c+ DCs/well on 24-well plates in MEM-alpha (ThermoFisher Scientific) including 5% serum (Hyclone ...
-
bioRxiv - Cell Biology 2020Quote: ... containing 10 ng/ml recombinant human IL-2 (Gibco, Thermo Fisher), 10% heat-inactivated Fetal Calf Serum (Gibco ...
-
bioRxiv - Cell Biology 2020Quote: ... containing 10 ng/ml recombinant human IL-2 (Gibco, Thermo Fisher), 10% heat-inactivated Fetal Calf Serum (Gibco ...
-
bioRxiv - Cancer Biology 2019Quote: ... and 2.5 ng/mL of recombinant human IL-2 (Thermofisher, PHC0027). T-cells were co-cultured with the mCherry-Nucleus-7 MCF7 cells in the presence of CellEvent™ Caspase-3/7 Green Detection Reagent (ThermoFisher ...
-
bioRxiv - Immunology 2019Quote: ... supplemented with 5 ng/mL recombinant human interleukin 2 (Gibco, #PHC0027), 2 mM L-glutamine (Lonza ...
-
bioRxiv - Cancer Biology 2021Quote: ... and 2 ng/ml recombinant human FGF-Basic (Thermo Fisher Scientific) in a humidified incubator with 5% CO2 at 37°C ...
-
bioRxiv - Immunology 2021Quote: ... with 17 ng/ml of recombinant human IL-2 (ThermoFisher Scientific). MART-1-specific CD8+ T-cell clones were generated by Friedmann et al (Friedmann et al. ...
-
bioRxiv - Cell Biology 2020Quote: ... mouse anti-alpha-Tubulin AA4.3-c (1:5000; DSHB)) were detected using HRP-conjugated secondary antibodies (1:10000; Thermo Fisher) and ECL Prime kit (Amersham) ...