Labshake search
Citations for Thermo Fisher :
301 - 350 of 10000+ citations for 7 Bromo 1 methyl 1H indole 97% since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: ... 5-bromo-4-chloro-3-indolyl phosphate (BCIP)/nitro blue tetrazolium (NBT) substrate (Thermo Fisher Scientific, cat.: 34042) was added and the reaction was terminated after 5 min under running tap water ...
-
bioRxiv - Plant Biology 2024Quote: ... or X-Gal (5-bromo-4-chloro-3-indolyl-b-D-galactopyranoside, W5376C; Thermo Fisher Scientific, Guilford, CT). GUS and/or LacZ-stained tissues were cleared for 30 s with 12 % sodium hypochlorite solution before microscopy observations.
-
bioRxiv - Genetics 2019Quote: ... Day 6–7: DMEM (Gibco) with 25 mM glucose containing 1:100 B27 (Gibco ...
-
bioRxiv - Cancer Biology 2020Quote: ... and 7-AAD (Thermofisher Scientific) for 30min ...
-
bioRxiv - Developmental Biology 2021Quote: ... 7 (Applied Biosystems, Zug, Switzerland).
-
bioRxiv - Cancer Biology 2021Quote: ... 7-AAD (ThermoFisher Scientific, #A1310), AnnexinV-PE (BioLegend ...
-
bioRxiv - Cancer Biology 2022Quote: ... 7’-Dichlorofluorescin diacetate (DCFDA; Invitrogen). DCFDA is de-esterified into its fluorescent form after action of intracellular esterases and oxidation by reactive oxygen species within the cell (Ishii et al. ...
-
bioRxiv - Microbiology 2021Quote: ... MgCl2 (ThermoFisher AM9530G; 7 mM), and SmartScribe Reverse Transcriptase (TaKaRa 639538 ...
-
bioRxiv - Neuroscience 2021Quote: ViiA 7 system (Applied Biosystems)
-
bioRxiv - Cell Biology 2021Quote: ... 7’ dichlorofluorescein diacetate (DCFDA, Invitrogen at 37°C for 30 min ...
-
bioRxiv - Developmental Biology 2020Quote: Cos-7 cells (Thermo Fisher Scientific ...
-
bioRxiv - Cancer Biology 2022Quote: ... 7-AAD (Thermo Fisher Scientific) and Annexin-V PE (BD ...
-
bioRxiv - Biophysics 2022Quote: ... 7 kDa MWCO (Thermo Scientific). Terminase protomer was exchanged into a 200 mM ammonium acetate salt ...
-
bioRxiv - Developmental Biology 2023Quote: ... using 7-AAD (ThermoFisher Scientific) as a dead stain.
-
bioRxiv - Developmental Biology 2023Quote: ... using 7-AAD (ThermoFisher Scientific) as a dead cell stain ...
-
bioRxiv - Bioengineering 2024Quote: ... 7 kDa MWCO (Thermo Scientific). The extent of biotinylation was measured using the QuantTag Biotin Quantification kit (Vector Laboratories ...
-
bioRxiv - Microbiology 2022Quote: ... Briefly HEK 293T rLuc-GFP 1–7 effector cells were transfected in OptiMEM (Gibco) using Transit-X2 transfection reagent (Mirus) ...
-
bioRxiv - Biophysics 2020Quote: ... pH 7) and incubated with 1:1.5 molar ratio of AF488 (C5 maleimide, Invitrogen) for 1 h ...
-
bioRxiv - Developmental Biology 2021Quote: ... Dead cells were excluded either via 7-aminoactinomycin D staining 1:1000 (7AAD, Invitrogen) or Sytox AAD (1:5000 ...
-
bioRxiv - Immunology 2020Quote: ... 2 mM EDTA and 1 µl of 7-AAD (Thermo Fisher, Waltham, MA, USA). 7-AAD-positive cells were quantitated by flow cytometry and analyzed with FloJo software (FloJo LLC. ...
-
bioRxiv - Microbiology 2019Quote: ... Haematopoietic stem cells differentiated into BMDMs by incubating for 7 days in BMDM medium (1:1 SFM:DMEM, Gibco) supplemented with 10 % FCS (Biochrom) ...
-
bioRxiv - Developmental Biology 2023Quote: ... Aggregation medium (BSA supplemented N2B@7 media) consisted in 500ml 1:1 mix of Neurobasal (Invitrogen 21103-049) and DMEM/F12 (Invitrogen 21331) ...
-
bioRxiv - Genomics 2022Quote: ... 97 Samples were measured using a Q Exactive Plus Orbitrap LC–MS/MS System (Thermo Fisher). For each sample ...
-
bioRxiv - Cell Biology 2022Quote: ... or siRNAs against mouse Adgrg6 (MSS278013: #13 CGACUGCCAAGGGCCUGUCAUUUAA MSS210995: #95 GCCUCCAAAUUUGCUUGAGAAUUUA; MSS210997: #97 CCGUGUUACCCUAAUGACUACCCUA, ThermoFisher Scientific). Transfection was performed using Lipofectamine 2000 (LS11668019 ...
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Biochemistry 2021Quote: ... Transfection of MCF-7 and MCF-7/ADR cells was performed with Lipofectamine 3000 (Invitrogen) according to the manufacturer’s instructions ...
-
bioRxiv - Molecular Biology 2019Quote: Hematopoietic precursor cell-7 (HPC-7) cells were grown in IMDM medium (12440-053, Invitrogen) with 10% FBS ...
-
bioRxiv - Microbiology 2020Quote: ... and single cell suspensions stained with 7-aminoactinomycin D (7-AAD; ThermoFisher Scientific, Waltham, Massachusetts) were analyzed on an LSR II flow cytometer (Becton Dickinson).
-
bioRxiv - Immunology 2020Quote: ... Cell death was assessed by 7-aminoactinomycin D (7-AAD, Affymetrix eBioscience, San Diego, CA) staining and flow-cytometry (FACSCantoII™ ...
-
bioRxiv - Neuroscience 2019Quote: ... Cells were washed twice with PBST followed by 1h incubation at RT with anti-rabbit Alexa FluorTM 488 (1:200; Thermo Fisher Scientific, A11001) and Alexa FluorTM 568 phalloidin (1:200 ...
-
bioRxiv - Molecular Biology 2019Quote: ... Cells were then incubated for 1h with secondary antibodies conjugated with Alexa Fluor 594 fluorescent dyes (Molecular Probes, 1:400 dilution in PBS+). Then ...
-
bioRxiv - Biophysics 2019Quote: ... The membranes were incubated for 1h with 1:2000 dilution of HRP conjugated anti-FLAG monoclonal antibody (Thermo Fisher Scientific MA1-91878-HRP) at room temperature ...
-
bioRxiv - Neuroscience 2019Quote: ... They were then washed 3 times with PBS and incubated for 1h at room temperature in secondary antibody (1:1000; ThermoFisher, Cambridge, MA; R37117). They were then washed once with PBS ...
-
bioRxiv - Developmental Biology 2024Quote: ... Maturation of released oocytes was induced by incubating for 1h at 16°C in 3 μM 1-Methyladenine (Fisher Scientific, 5142-22-3).
-
bioRxiv - Molecular Biology 2022Quote: ... Cells were allowed to grow for 96 h in drug containing medium (methyl methanesulfonate, Acros Organics 156890250, mitomycin C, Sigma M4287, 4-nitroquinoline 1-oxide, Sigma N8141, hydroxyurea, Acros Organics 151680250 ...
-
bioRxiv - Plant Biology 2022Quote: ... the acidic protons were subsequently derivatized with 90 μL of N-methyl-N-trimethylsilyltrifluoroacetamide plus 1% trimethylchlorosilane (Thermo Fisher Scientific, Waltham, MA) at 37°C for 30 min ...
-
bioRxiv - Pathology 2022Quote: ... as above and left to attach for 2 hours before adding bromodeoxyuridine / 5-bromo-2’-deoxyuridine (BrDU, Invitrogen B23151) to a final concentration of 75 µM and left to proliferate for 6 hours ...
-
bioRxiv - Cell Biology 2019Quote: ... HRP-conjugated secondary antibodies were incubated for 1h before visualisation using ECL (ThermoFisher #34096)
-
bioRxiv - Bioengineering 2020Quote: ... for 1h at room temperature and embedded in HistoGel Specimen Processing Gel (Thermo Fisher) prior to paraffin processing ...
-
bioRxiv - Cancer Biology 2020Quote: ... mitochondria were stained for 1h with 200nM MitoTracker Deep Red (M22426, Thermo Fisher Scientific). After ...
-
bioRxiv - Neuroscience 2020Quote: ... and then 1h incubation in streptavidin-Alexa 568 conjugate Alexa 647-conjugate (Thermo Fisher Scientific Cat# S-21374 ...
-
bioRxiv - Molecular Biology 2022Quote: ... then for 1h at RT with prepared dynabeads sheep anti rabbit IgG (Invitrogen, #11203D). Coprecipiate was washed once with wash buffer (polysomal buffer ...
-
bioRxiv - Neuroscience 2024Quote: ... sections were incubated for 1h at 25°C in Alexa Fluor® 647 (Invitrogen) goat anti-rabbit secondary antibody (1:500 in 1% BSA-TBS).
-
bioRxiv - Cell Biology 2021Quote: ... 5 L-malic acid and 20 μM tetramethylrhodamine methyl ester (TMRM, Thermo Fisher) for 10 minutes ...
-
bioRxiv - Neuroscience 2021Quote: ... Fly brains were incubated with 100 nM Tetramethylrhodamine methyl ester (TMRM) (Invitrogen, I34361) for 30 min at 37 °C and washed three times with Hank’s balanced salt solution (HBSS) ...
-
bioRxiv - Neuroscience 2019Quote: ... The co-cultures were stained with tetramethylrhodamine methyl ester (TMRM, Invitrogen; 250 nM) for 45 min at 37 °C ...
-
bioRxiv - Molecular Biology 2020Quote: ... cells were loaded with 10 nM Tetramethyl Rhodamine Methyl Ester (TMRM) (Molecular Probes) and incubated at 37°C for 30 min ...
-
bioRxiv - Genomics 2020Quote: ... and the mitochondria-specific dye tetramethylrhodamine methyl ester (TMRM, 25nM; Thermo Fisher Scientific) diluted in Hanks solution (Gibco ...
-
SMDT1 variants impair EMRE-mediated mitochondrial calcium uptake in patients with muscle involvementbioRxiv - Genetics 2022Quote: ... Cells were incubated with 15 nM tetramethyl rhodamine methyl ester (TMRM; #T668; Invitrogen) in culture medium for 25 min at 37°C and 5% CO2 in the dark ...
-
bioRxiv - Cell Biology 2023Quote: ... FM4-64 and leucyl-L-leucine methyl ester (LLOMe) were from Thermo Fisher Scientific ...