Labshake search
Citations for Thermo Fisher :
51 - 100 of 10000+ citations for 6 FLUOROCHROMONE 3 CARBONITRILE 97 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2023Quote: ... heated for 3 mins at 90C and separated on a 6% denaturing PAGE gel (Invitrogen). The RNA was then transferred to a HyBond-N+ nylon membrane (GE Life Sciences ...
-
bioRxiv - Neuroscience 2023Quote: Primary mouse microglia were plated at a density of 3×105 in 6 well plates and treated for 6 h prior to RNA extraction with Trizol (Invitrogen; Taïb et al., 2013). Adult microglia were treated as described in section 2.2.3 prior to extraction of total RNA using RNeasy Plus Mini Kit (Qiagen ...
-
bioRxiv - Immunology 2021Quote: ... Mice were genotyped by PCR using forward primers 5’-ctgagcagagacccactgaaag-3’ and reverse primers 5’- ggatctggcttctgagtttgtgta-3’ and amplicons were ran in 6% TBE gels (Life Technologies, Carlsbad, CA).
-
bioRxiv - Neuroscience 2021Quote: ... Nucleus staining was performed using 4’,6-diamidino-2-phenylindole (DAPI) (3 mM, D3571, Molecular Probes). Cells were counted from four randomly selected fields per culture under a confocal microscope (TCS SP8 ...
-
bioRxiv - Cell Biology 2022Quote: ... 3-6 dpf larval zebrafish were anesthetized using 0.2 mg/mL Tricaine-S (Fisher Scientific, NC0872873) solution ...
-
bioRxiv - Biochemistry 2021Quote: ... 2-[6-(4’-hydroxy) phenoxy-3H-xanthen-3-on-9-yl] benzoate (HPF) from Molecular Probes® and Horse radish peroxidase (HRP ...
-
bioRxiv - Physiology 2021Quote: 2-3 viable human slices were incubated with Fluo4-AM (6 μM, Invitrogen cat. No. F1221) for 1h in 3 mM HEPES buffer (125 mmol/l NaCl ...
-
bioRxiv - Biochemistry 2021Quote: ... 3-[p-(6-phenyl)-1,3,5-hexatrienyl] phenylpropionic acid was purchased from Molecular Probes (Eugene, OR, USA) and 1-stearoyl-2-linoleoyl-sn-glycerol-3-phosphocholine (SLPC ...
-
bioRxiv - Biochemistry 2023Quote: ... batches of 3-6 SC-islets were embedded in extracellular matrix (Geltrex, Gibco, cat. n A1569601) and cultured for 7 days under perfusion ...
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... Triethylamine and 5-hehyn-1-ol 97% were purchased from Acros Organics (Geel, Belgium). Deuterium oxide (D2O ...
-
bioRxiv - Developmental Biology 2021Quote: ... TRAP staining was performed using the ELF-97 endogenous phosphatase detection kit (Thermo Scientific). A Zeiss LSM800 confocal microscope was used for fluorescent imaging at the BWH Confocal Microscopy Core.
-
bioRxiv - Cancer Biology 2022Quote: ... and 97°C for 10 min in a Lab Vision PT module (Thermo Fisher). After blocking of non-specific binding with CODEX FFPE blocking solution ...
-
bioRxiv - Immunology 2022Quote: ... Encapsulation efficiencies were >97% as measured by the Quant-iT Ribogreen Assay (Life Technologies).
-
bioRxiv - Cell Biology 2023Quote: ... Each condition required 97 µL of room-temperature 1x Opti-MEM (Gibco Cat# 31985070), 1 µL each DNA plasmid at 1µg/µL concentration) ...
-
bioRxiv - Biochemistry 2024Quote: ... Each condition required 97 µL of room-temperature 1x Opti-MEM (Gibco Cat# 31985070), 1 µL each DNA TRUPAPH plasmid at 1µg/µL concentration) ...
-
bioRxiv - Developmental Biology 2019Quote: Total RNA from whole retinas was extracted using TRIzol (6 retinas from 3 fish per sample) (Invitrogen). RNA was quantified using Nanodrop spectrophotometer (Thermo Fisher Scientific) ...
-
bioRxiv - Microbiology 2021Quote: ... Reverse 5’-CGA AGG TGT GAC TTC CATG-3’) on a QuantStudio 6 Flex thermocycler (Applied Biosystems). A standard curve was established in parallel using purified SARS-CoV-2 viral RNA.
-
bioRxiv - Developmental Biology 2022Quote: ... On day 3-9 cells were fed daily with Essential 6 medium (E6, #A1516401, Thermo Fisher Scientific) in the presence of 100 nM LDN193189 (#72142 ...
-
bioRxiv - Immunology 2020Quote: ... plates were incubated with 2,2’-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid) substrate (ABTS, Thermo Fisher Scientific) for 15 min at RT shielded from light and absorbance was measured at optical density (OD ...
-
bioRxiv - Plant Biology 2022Quote: ... N-(3-triethylammoniumpropyl)-4-(6-(4-(diethylamino) phenyl) hexatrienyl) pyridinium dibromide (FM 4-64; 50 μM) (Invitrogen) or propidium iodide (PI ...
-
bioRxiv - Molecular Biology 2023Quote: U2OS 2-6-3 cells (Shanbhag et al., 2010) were cultured in McCoy’s 5A (Modified) Medium (Gibco) supplemented with 10% fetal bovine serum (FBS ...
-
bioRxiv - Cell Biology 2023Quote: ... DAPI (4’,6-Diamidino-2-henylindole, dihydrochloride) was obtained from Invitrogen (Catalog: D1306, CAS:28718-90-3).
-
bioRxiv - Neuroscience 2023Quote: ... 6 and 8 weeks of maturation were loaded with 2.5 µM Fluo-3-AM (Molecular Probes, #F1242) dissolved in differentiation medium for 30 min at 37 °C and at 5% CO2 ...
-
bioRxiv - Microbiology 2021Quote: ... a 97 nucleotide fragment of the spike ORF was cloned into the pJET1.2 vector (Invitrogen). Following linearization with HindIII ...
-
bioRxiv - Neuroscience 2022Quote: ... prepared according to manufacturer’s specifications with 97 mL of Neurobasal® Medium (Gibco®, 21103), 2 mL of B-27® Serum-Free Supplement (Gibco® ...
-
bioRxiv - Plant Biology 2020Quote: ... on 4-16% (Figures 4A and 7) or 3-12% (Figures 4C and 6) NativePAGE gels (Life technologies). Cathode Running buffer (Life technologies ...
-
bioRxiv - Biophysics 2019Quote: ... 4-(2-(6-(dibutylamino)-2-naphthalenyl)ethenyl)-1-(3-sulfopropyl)-,hydroxide (di-4-ANEPPS) was purchased from Invitrogen. It was dissolved in ethanol and added to the dried lipid film at a 12:1 lipid:probe molar ratio ...
-
bioRxiv - Biochemistry 2021Quote: ... and then diluted into fresh YPD for 3-6 hours before inoculating into 96-well plates (Thermo Scientific) at a starting OD600 between 0.04 to 0.1 ...
-
BRD2 inhibition blocks SARS-CoV-2 infection by reducing transcription of the host cell receptor ACE2bioRxiv - Cell Biology 2021Quote: ... Reverse 5′-CGA AGG TGT GAC TTC CAT G-3′) on a QuantStudio 6 Flex thermocycler (Applied Biosystems). Standard curve was established in parallel using purified SARS-CoV-2 viral RNA.
-
bioRxiv - Biochemistry 2021Quote: ... and then diluted into fresh YPD for 3-6 hours before inoculating into 96-well plates (Thermo Scientific) at a starting OD600 between 0.04 to 0.1 ...
-
bioRxiv - Neuroscience 2022Quote: ... the cerebral cortexes from 2-3 P3-P5 C57BL/6 mice were collected in ice cold HBSS (Invitrogen), the tissue was washed three times with HBSS and digested with 0.04% trypsin (Sigma ...
-
bioRxiv - Cell Biology 2022Quote: HCT116 cells were cultured in a 6-well plate at 300,000 cells per well in 3 ml McCoy’s 5A medium (Gibco) supplemented with 10% heat inactivated FBS and with 90 UI/mL Penicillin ...
-
bioRxiv - Neuroscience 2020Quote: Neocortex from C57Bl/6 pups (postnatal day 1-3) was dissected in Hibernate-A medium (#A1247501, Gibco, USA), digested with papain (#LS003124 ...
-
bioRxiv - Cell Biology 2022Quote: ... For the bulk endocytosis experiments using the 4-[6-[4-(diethylamino)phenyl]-1,3,5-hexatrien-1-yl]-1-[3-(triethylammonio)propyl]-pyridiniumbromide dye (FM 4-64, Invitrogen), the cells were prepared as previously described [41] ...
-
bioRxiv - Cell Biology 2023Quote: ... X-biotin-PE [N-((6-(biotinoyl)amino)hexanoyl)-1,2-dihexadecanoylsn-glycero-3-phosphoethanolamine] was obtained from Thermo Fisher Scientific ...
-
bioRxiv - Genomics 2023Quote: ... All nuclei were pooled and stained with DAPI (4′,6-diamidino-2-phenylindole, 3 uM final) (Invitrogen, D1306). Using a FACSAria III cell sorter (BD Biosciences) ...
-
bioRxiv - Biophysics 2023Quote: ... in 3% BSA with a 1:50 ratio and 4’,6-diamidino-2-phenylindole (DAPI, Thermo Fisher Scientific) were employed ...
-
bioRxiv - Biochemistry 2023Quote: ... cells were marked with 2,3x10-3 µg/µL 4’,6-Diamidino-2-phenylindole dihydrochloride (DAPI, Thermo Fisher Scientific) for 10 min at RT in the dark ...
-
bioRxiv - Molecular Biology 2024Quote: Total RNA was extracted from 30 ovaries from 3-6 day-old flies using TRIzol (Thermo Fisher Scientific) in three replicates ...
-
bioRxiv - Physiology 2020Quote: ... interleukin 6 (IL-6; Invitrogen, Carlsbad, CA), plasminogen activator inhibitor 1 (PAI-1 ...
-
bioRxiv - Genomics 2022Quote: ... 97 Samples were measured using a Q Exactive Plus Orbitrap LC–MS/MS System (Thermo Fisher). For each sample ...
-
bioRxiv - Cell Biology 2022Quote: ... or siRNAs against mouse Adgrg6 (MSS278013: #13 CGACUGCCAAGGGCCUGUCAUUUAA MSS210995: #95 GCCUCCAAAUUUGCUUGAGAAUUUA; MSS210997: #97 CCGUGUUACCCUAAUGACUACCCUA, ThermoFisher Scientific). Transfection was performed using Lipofectamine 2000 (LS11668019 ...
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Biochemistry 2020Quote: ... HEK 293 cells were plated onto 6-well plates (2.5-4.5 × 105 cells per well) in 3 ml of MEM (Life Technologies) with 10% FBS (Life Technologies ...
-
bioRxiv - Cell Biology 2021Quote: ... embryos at the 3-6 somite stage were embedded oriented laterally in 1% low-melt agarose (Invitrogen, Carlsbad, CA) and imaged under bright field (to determine yolk elongation by taking major and minor axis measurements ...
-
bioRxiv - Cancer Biology 2021Quote: ... Cells were incubated with lentiviral supernatant and 3 days later selection begun with 6 μg/mL puromycin (Thermo Fisher), which was maintained during all subsequent culturing.
-
bioRxiv - Microbiology 2022Quote: ... and N-((6-(biotinoyl)amino)hexanoyl)-1,2-dihexadecanoyl-sn-glycero-3-phosphoethanolamine (biotin-X DHPE; Molecular Probes, Life Technologies). Planar bilayers were formed from 200-nm liposomes in channels of a PDMS flow-cell using vesicle spreading method (36) ...
-
bioRxiv - Microbiology 2022Quote: ... and N-((6-(biotinoyl)amino)hexanoyl)-1,2-dihexadecanoyl-sn-glycero-3-phosphoethanolamine (biotin-X DHPE; Molecular Probes, Life Technologies). Planar bilayers were formed from 200-nm liposomes in channels of a PDMS flow-cell using vesicle spreading method (36) ...
-
bioRxiv - Molecular Biology 2020Quote: ... flushed with argon prior to adding hydrochloric acid (3 mL of 6 M sequencing grade solution; Thermo Scientific #PI24308). Sealed tubes were kept at 125° C for 48h (oil bath ...
-
bioRxiv - Cancer Biology 2021Quote: ... cells were marked with 2,3×10−3 μg/μL 4’,6-Diamidino-2-phenylindole dihydrochloride (DAPI, Thermo Fisher Scientific) for 10 minutes at room temperature in the dark ...