Labshake search
Citations for Thermo Fisher :
3501 - 3550 of 5129 citations for PLXDC1 Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2023Quote: ... The trapped peptides were separated on an Acclaim PepMap RSLC nanoViper column (75µm x 500mm, C-18, 2µm, 100Å, Thermo Fisher) at 300 nL/min flow rate and 40 °C column temperature using water and acetonitrile with 0.1% formic acid as solvents A and B ...
-
bioRxiv - Microbiology 2023Quote: ... Peptides were separated using a 140 min gradient generated by an EASY-nLC 1200 liquid chromatography (Thermo Fisher Scientific) heated to 50 °C by a PRSO-V1 column oven (Sonation) ...
-
bioRxiv - Cancer Biology 2023Quote: ... peptides were directly sprayed into an Orbitrap Fusion Lumos mass spectrometer equipped with a nanoFlex ion source (ThermoFisher Scientific).
-
bioRxiv - Microbiology 2023Quote: ... Peptides were separated using a 140 min gradient generated by an EASY-nLC 1200 liquid chromatography (Thermo Fisher Scientific) heated to 50 °C by a PRSO-V1 column oven (Sonation) ...
-
Pan-tissue mitochondrial phenotyping reveals lower OXPHOS expression and function across tumor typesbioRxiv - Biochemistry 2023Quote: ... The multiplexed peptide sample was subjected to high pH-reversed-phase fractionation according to the manufacturer’s instructions (Thermo Fisher). In this protocol ...
-
bioRxiv - Cell Biology 2023Quote: ... HDFs were cultured for 72 hours in the presence of each peptide (at 3-12.5 ppm)in Dulbecco’s modified Eagle’s medium (DMEM, Gibco #21969-035) supplemented with 10% fetal bovine serum (FBS ...
-
bioRxiv - Immunology 2023Quote: ... peptides were first loaded onto a trap cartridge (ThermoFisher PepMap, C18, 5 μm, 100 μm i.d. x 20 mm), then eluted onto a reversed phase Easy-Spray column (ThermoFisher PepMap ...
-
bioRxiv - Systems Biology 2023Quote: ... with 2 μm bead size was used for peptide separation in an EASY-nLC 1200 HPLC (Thermo Fisher Scientific). Peptides were separated in a gradient composed as follows ...
-
bioRxiv - Molecular Biology 2023Quote: ... The eluted peptides were sprayed directly by electrospray ionization into a Q Exactive Plus Orbitrap mass spectrometer (Thermo Scientific). Mass spectrometry measurement was conducted in data-dependent acquisition mode using a top10 method with one full scan (mass range ...
-
bioRxiv - Developmental Biology 2023Quote: ... Peptides were then separated (EASY-Spray; PepMap RSLC C18, 75 μm × 50 cm, 2 μm particles, Thermo Fisher Scientific) at a flow rate of 250 ηL min-1 employing a two-step gradient ...
-
bioRxiv - Neuroscience 2023Quote: ... was used to elute peptides from the capillary reverse-phase column (0.075 × 150 mm, Pepmap®, Thermo Fisher Scientific). Data were acquired using the Xcalibur software ...
-
bioRxiv - Biochemistry 2023Quote: We labeled 10 µg of tryptic peptides from each experiment with a TMT10plex Isobaric Labeling Reagent kit (Thermo Scientific) (Zecha et al. ...
-
bioRxiv - Systems Biology 2023Quote: ... the dried peptides were dissolved in 250 µL of buffer A (0.1% formic acid in H2O) (Thermo Fisher Scientific) with 1:2500 (v/v ...
-
bioRxiv - Cell Biology 2023Quote: ... Chromatographic separation of the peptides was performed by liquid chromatography on a nano-HPLC system (Ultimate 3000, Thermo Scientific) using a nano-LC column (Acclaim PepMapC100 C18 ...
-
bioRxiv - Cell Biology 2023Quote: ... An aliquot containing ∼ 100 µg of peptides was removed and labeled with Tandem-Mass-Tag (TMT) reagent (ThermoFisher Scientific). Once labeling efficiency was confirmed to be at least 95% ...
-
bioRxiv - Microbiology 2023Quote: ... and tryptic peptides were cleaned using a C18 column and dried with a SpeedVac concentrator (Thermo Fisher Scientific, USA). The peptides were quantified using the Pierce Quantitative Colorimetric Peptide Assay Kit ...
-
bioRxiv - Microbiology 2023Quote: ... USA).The resulting peptides were sequenced on a Q-Exactive Hybrid Quadrupole-Orbitrap Mass Spectrometer (ThermoFisher Scientific, Rockford, IL, USA) at the Vienna Research Platform for Metabolomics & Proteomics and analyzed using the Proteome Discoverer v2.2.0.388 (ThermoFisher Scientific ...
-
Short-range interactions between fibrocytes and CD8+ T cells in COPD bronchial inflammatory responsebioRxiv - Pathology 2023Quote: ... Each peptide extracts were loaded on a 300 µm ID x 5 mm PepMap C18 precolumn (Thermo Scientific, USA) at a flow rate of 10 µL/min ...
-
bioRxiv - Microbiology 2024Quote: ... Peptides were separated using a 140 min gradient generated by an EASY-nLC 1000 liquid chromatography (Thermo Fisher Scientific) with the column heated to 50 °C by a PRSO-V1 column oven (Sonation) ...
-
bioRxiv - Microbiology 2023Quote: ... Peptide separation was carried out using an Acclaim PepMap RSLC C18 column (75 μm × 50 cm; Thermo Fisher Scientific) using standard reverse-phase gradients ...
-
bioRxiv - Microbiology 2023Quote: The peptide mixture from the biological replicates was analyzed by LTQ Velos Orbitrap mass spectrometer (Thermo Fisher Scientific, USA) coupled with liquid chromatography-tandem mass spectrometry using an EASYnLC system (Thermo Fisher Scientific).
-
bioRxiv - Neuroscience 2023Quote: ... Peptides were gradient eluted from the column directly to Eclipse mass spectrometer using a 1 hour gradient (Thermo Scientific) using 2% acetonitrile and 0.5% acetic acid for solvent A and 80% acetonitrile and 0.5% acetic acid for solvent B.
-
bioRxiv - Molecular Biology 2023Quote: ... applying settings from the literature for analyzing HLA peptides (Bassani-Sternberg et al. 2015) and ProteomeDiscoverer 2.3 software (Thermofisher). Raw data has been deposited to ProteomeXchange Consortium via the MassIVE partner repository with data set identifier PXD042439.
-
bioRxiv - Biochemistry 2023Quote: Tryptic peptides were analyzed by LC-MSMS using a Q Exactive Plus mass spectrometer (Thermo Fisher Scientific, Bremen, Germany). Peptide mixtures were fractionated by an Ultimate 3000 RSLCnano (Thermo Fisher Scientific ...
-
bioRxiv - Biochemistry 2023Quote: ... The peptides were first concentrated on a precolumn (PepMap100 C18 3 μm; 75 μm × 2 cm; Thermo Fisher Scientific) and then separated on an EASY-Spray column (ES903 ...
-
bioRxiv - Bioengineering 2023Quote: The peptide digests were subjected to LC MS/MS analysis using an UltiMate 3000 RSLC system (Thermo Fisher Scientific) coupled in-line to an Orbitrap Fusion Lumos mass spectrometer (Thermo Fisher Scientific) ...
-
bioRxiv - Cancer Biology 2023Quote: ... Tryptic peptides were loaded onto a trap column (Pepmap 100 5μm, 5 × 0.3 mm, ThermoFisher Scientific, San Jose, CA) at a flow rate of 10 μL/min using 0.1% TFA as loading buffer ...
-
bioRxiv - Immunology 2023Quote: ... Separation of peptides was achieved using a DNV PepMap Neo separation column (75 µm x 150 mm, Thermo Scientific) and a gradient from 1 % to 40 % B within 120 min and a flowrate of 400 nL/min at 60 °C ...
-
bioRxiv - Immunology 2023Quote: ... LC/MS data acquisition parameters: Peptides were separated and analyzed on an EASY nLC 1200 System (Thermo Fisher Scientific) in-line with the Orbitrap Fusion Lumos Tribrid Mass Spectrometer (Thermo Fisher Scientific ...
-
bioRxiv - Immunology 2023Quote: ... LC/MS data acquisition parameters: Peptides were separated and analyzed on an EASY nLC 1200 System (Thermo Fisher Scientific) in-line with the Orbitrap Fusion Lumos Tribrid Mass Spectrometer (Thermo Fisher Scientific ...
-
bioRxiv - Cell Biology 2023Quote: The fractionated peptides were analysed by LC-MS/MS using a fully automated Ultimate 3000 RSLC nano System (ThermoFisher) fitted with a 100 μm x 2 cm PepMap100 C18 nano trap column and a 75 μm×25 cm ...
-
bioRxiv - Biochemistry 2023Quote: ... Peptides were then vacuum dried and concentration was determined by measuring the absorbance at 280/260 (NanoDrop, Thermo Scientific). 200μg of peptides in 100mM HEPES pH=8-5 were then labeled with 400µg of 11-plex TMT (Thermo ...
-
bioRxiv - Biochemistry 2023Quote: ... 1.5 µg of peptide was analysed on the Exploris 480 coupled with a Dionex Ultimate 3000 RS (Thermo Scientific). LC buffers prepared as follows ...
-
bioRxiv - Biochemistry 2023Quote: ... Eluted peptides were analysed by using an Orbitrap Fusion Lumos Tribrid Mass Spectrometer (Thermo Fisher Scientific, Waltham, MA, USA).
-
bioRxiv - Biophysics 2023Quote: The PUR4 (also known as FUD) peptide (sequence: KDQSPLAGESGETEYITEVYGNQQNPVDIDKKLPNETGFSGNMVETEDT) and the scrambled control (sequence: EKGYSKPPVGNEGGDQVDEYDTMSQTKLEDEGNTLISPITFENATEQVN) were synthesised by ThermoFisher Scientific without any tags or modifications ...
-
bioRxiv - Cell Biology 2023Quote: ... All native peptides not captured by the phosphopeptide enrichment kits were then separated by offline medium pH C4 peptide fractionation (Accucore 150-C4, 2.6um pore size, 150mm X 2.1mm, Thermo Scientific) using gradient mobile phase conditions as previously reported (76) ...
-
bioRxiv - Physiology 2024Quote: ... Approximately 7 µg of tryptic peptide from each tissue sample was labeled with TMT-Pro 16 plex (Thermo Scientific) reagents according to the manufacturer’s instructions ...
-
bioRxiv - Plant Biology 2024Quote: ... Eluting peptides were on-line ionized by nano-electrospray (nESI) using the Nanospray Flex Ion Source (Thermo Fisher Scientific) at 1.5 kV (liquid junction ...
-
bioRxiv - Bioengineering 2024Quote: ... Peptides were then analysed on a Ultimate 3500 RSLCnano system (Dionex) and a Q-Exactive HF (Thermo Fisher Scientific) mass spectrometer ...
-
bioRxiv - Systems Biology 2024Quote: DISPA of the plasma proteome peptides was performed on an Orbitrap Fusion Lumos™ mass spectrometer (Thermo Fisher Scientific) coupled with the FAIMS Pro Interface ...
-
bioRxiv - Plant Biology 2024Quote: ... peptide/ protein identification and MS1-based label-free quantification (LFQ) were performed using Proteome Discoverer 2.5 (PD2.5) (Thermo Scientific). For IP-MS analysis ...
-
bioRxiv - Physiology 2024Quote: ... Peptides were loaded in buffer A (0.1 % formic acid) onto a 110 cm mPAC HPLC column (Thermo Fisher Scientific) and separated with a non-linear gradient of 1 – 50 % buffer B (0.1 % formic acid ...
-
Spatiotemporal proteomics reveals the biosynthetic lysosomal membrane protein interactome in neuronsbioRxiv - Cell Biology 2024Quote: ... Peptides were loaded onto a trap column (C18 PepMap100, 5 μm, 100 Å, 5 mm × 300 μm, Thermo Fisher Scientific ...
-
bioRxiv - Physiology 2024Quote: ... the peptides were concentrated on an Accalaim μ-Precolumn (0.5 mm × 3 mm, particle size 5 μm; Thermo Scientific) in the isocratic mode at a 10 μL/min flow for 5 min in the mobile phase C (2% acetonitrile ...
-
bioRxiv - Immunology 2024Quote: ... Peptides were loaded onto an Acclaim PepMap100 nanoViper C18 trap column (100 µm inner diameter, 2 cm; Thermo Scientific) in HPLC buffer C with a constant flow of 10 µl/min ...
-
bioRxiv - Neuroscience 2024Quote: Fractionated peptides were analysed by LC-MS/MS using a fully automated Ultimate 3000 RSLC nano System (Thermo Scientific). Peptides were trapped with a PepMap100 C18 5 μm 0.3X5 mm nano trap column (Thermo Fisher Scientific ...
-
bioRxiv - Cell Biology 2024Quote: ... peptides were resolved using an EASY-Spray capillary HPLC column (ES902A, 75 µm × 25 µm, 100Å, 2μm, Thermo Scientific) and a Vanquish Neo UHPLC (Thermo Fisher Scientific ...
-
bioRxiv - Systems Biology 2024Quote: ... Peptides were separated on a 75 µm × 50 cm EASY-Spray C18 column (2 µm, 100 Å; Thermo Scientific) at 50 °C using a linear gradient from 10% to 40% B in 153 min with a flow rate of 200 nL/min ...
-
bioRxiv - Immunology 2024Quote: ... injections into both hind flanks of 0.5 μmol/mL MOG35-55 peptide emulsified in incomplete Freuds adjuvant (Cat# 77145; ThermoFisher) supplemented with 4 mg/mL heat-killed M ...
-
bioRxiv - Cancer Biology 2024Quote: ... reconstituted peptides were analysed on a Dionex Ultimate 3000 system coupled with the nano-ESI Fusion Lumos (Thermo Scientific). Peptides were loaded on the Acclaim PepMap 100 ...