Labshake search
Citations for Thermo Fisher :
3451 - 3500 of 5144 citations for Parkin Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2022Quote: ... The peptides were eluted into the source of an Orbitrap Fusion™ Tribrid™ mass spectrometer (Thermo Fisher Scientific). The spray voltage was set to 2.25 kV and the temperature of the heated capillary was set to 280°C ...
-
bioRxiv - Biochemistry 2022Quote: ... The peptides were eluted into the source of an Orbitrap Eclipse™ Tribrid™ mass spectrometer (Thermo Fisher Scientific). The spray voltage was set to 2.25 kV and the temperature of the heated capillary was set to 275°C ...
-
bioRxiv - Cell Biology 2022Quote: ... peptides in 1 % (vol/vol) formic acid were injected onto an Acclaim PepMap C18 nano-trap column (Thermo Scientific). After washing with 0.5 % (vol/vol ...
-
bioRxiv - Immunology 2022Quote: ... The resulting tryptic peptides were subsequently labelled using TMT-6plex Isobaric Mass Tagging Kit (Thermo Scientific, Rockford, IL, USA) according to the manufacturer’s instructions as follows ...
-
bioRxiv - Microbiology 2022Quote: LC-MS analysis of linear peptides (unmodified and phosphopeptides) was performed using a Dionex UltiMate 3000 system (Thermo Fisher) connected to a PepMap C-18 trap-column (0.075 x 50 mm ...
-
bioRxiv - Microbiology 2022Quote: ... Digested peptide mixtures were analyzed by LC-MS/MS on an Orbitrap Fusion Tribrid mass spectrometer (Thermo Fisher Scientific) equipped with an Easy-nLC 1200 HPLC (Thermo Fisher Scientific) ...
-
bioRxiv - Systems Biology 2022Quote: Peptides from each sample were analyzed on an Orbitrap HF-X mass spectrometer (Thermo Fisher Scientific, San Jose, CA) using an overlapping window data-independent analysis (DIA ...
-
bioRxiv - Plant Biology 2022Quote: ... the peptide identification was performed by searching the Arabidopsis thaliana reference genome (downloaded from https://www.uniprot.org) using SEQUEST (ThermoFisher Scientific) search engine ...
-
bioRxiv - Plant Biology 2022Quote: ... Pooled samples were subjected to high pH fractionation using Pierce High pH Reversed-Phase Peptide Fractionation Kit (Thermo Scientific) following manufacturer instructions ...
-
bioRxiv - Genomics 2022Quote: ... tryptic peptides (1 mg) were decomplexed by reversed phase nanoLC separation (Ultimate 3000 nanoRSLC; Thermo Fisher Scientific, Dreieich, Germany) using a trap column setup (2 cm length ...
-
bioRxiv - Microbiology 2022Quote: ... LC-MS/MS analysis of digested peptides was performed on an Orbitrap Eclipse mass spectrometer (Thermo Fisher Scientific, Bremen) coupled to an EASY-nLC 1000 (Thermo Fisher Scientific) ...
-
bioRxiv - Plant Biology 2022Quote: ... the resulting peptides were quantified via absorbance measurements at 205 nm using a NanoDrop 2000c spectrophotometer (Thermo Fisher Scientific) and then injected into a NanoAcquity ultra-performance LC coupled to a Q-TOF SYNAPT G2-Si mass spectrometer (Waters ...
-
bioRxiv - Microbiology 2023Quote: ... The peptide concentrations were determined by BCA assay using the Pierce Rapid Gold BCA Protein Assay Kit (ThermoFisher Scientific), and the protein concentration was determined by UV absorbance at 280 nm ...
-
bioRxiv - Microbiology 2023Quote: ... Peptides were trapped on a C18 column (75 μm inner diameter × 2 cm; NanoViper Acclaim PepMapTM 100, Thermo Scientific) with buffer A (2/98 MeCN/H2O in 0.1% formic acid ...
-
bioRxiv - Microbiology 2023Quote: ... Peptides were trapped on a C18 column (75 μm inner diameter × 2 cm; NanoViper Acclaim PepMapTM 100, Thermo Scientific) with buffer A (2/98 MeCN/H2O in 0.1% formic acid ...
-
bioRxiv - Genomics 2022Quote: Peptide samples were solubilized in 0.1% formic acid and fractionated using a nano-LC Easy 1000 system (Thermo Fisher) coupled to an Orbitrap-type mass spectrometer (Q Exactive Plus ...
-
bioRxiv - Neuroscience 2022Quote: ... The peptide samples were analysed on an LTQ-OrbitrapXL mass spectrometer Kit (Thermo Fisher Scientific, Rock ford, IL, USA) coupled to the Eksigent nanoLC-Ultra® 2D system (AB Sciex ...
-
Multiomic Approach Characterises the Neuroprotective Role of Retromer in Regulating Lysosomal HealthbioRxiv - Neuroscience 2022Quote: ... peptides in 1% (vol/vol) formic acid were injected onto an Acclaim PepMap C18 nano-trap column (Thermo Scientific). After washing with 0.5% (vol/vol ...
-
bioRxiv - Neuroscience 2022Quote: ... The peptides obtained were extracted with 50 mM AmBic buffer and dried with a SpeedVac (Thermo Fisher Scientific, USA) and stored at −80 °C prior to quantitative and qualitative analyses by shotgun mass spectrometry (MS) ...
-
bioRxiv - Plant Biology 2022Quote: ... Peptides were analyzed by MS as follows: a 1 μL injection was made onto a C8 trap column (ThermoFisher, μ-precolumn – 300 μm i.d ...
-
bioRxiv - Plant Biology 2022Quote: ... Analysis of the eluted tryptic peptides was performed online using a Q Exactive™ Plus mass spectrometer (Thermo Scientific) possessing a Nanospray Flex™ Ion source (Thermo Fisher ...
-
bioRxiv - Plant Biology 2022Quote: Peptides were eluted at 300 nL/min from a 75 μm x 50 cm PepMap C18 column (Thermo Scientific) using the following gradient ...
-
bioRxiv - Cancer Biology 2022Quote: Peptide mass spectra were acquired using either Orbitrap Fusion Lumos or Orbitrap Eclipse Tribrid mass spectrometer (Thermo Fisher Scientific) with MS1 Orbitrap resolution of 240000 and MS/MS fragmentation of the precursor ions by collision-induced dissociation (CID ...
-
bioRxiv - Microbiology 2022Quote: The concentration of peptide stock solution was determined by absorption measurement at 205 nm using a Nanodrop instrument (ThermoFisher), and confirmed using a Pierce(tm ...
-
bioRxiv - Immunology 2022Quote: ... 750,000 PBMCs were incubated either with DMSO (negative control) or with 9-mer and 15-mer peptides in 0.5 ml RPMI (Gibco) +10% Human AB serum (Sigma ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... Eluting peptides were on-line ionized by nano-electrospray (nESI) using the Nanospray Flex Ion Source (Thermo Fisher Scientific) at 1.5 kV (liquid junction ...
-
bioRxiv - Cancer Biology 2022Quote: ... Peptides were loaded onto a C18 trap column (Acclaim PepMap, 100 A 5 µm particle size, Thermo Fisher Scientific) at a flow rate of 5 µL/min in Solvent A (0.1% formic acid in water ...
-
bioRxiv - Cell Biology 2022Quote: ... This combined sample was then subjected to fractionation using the high pH reversed-phase peptide fractionation kit (Thermo Fisher) for a final of six fractions for the nuclear eluates ...
-
bioRxiv - Neuroscience 2024Quote: ... Measurements of peptide library fractions were performed on a quadrupole-ion-trap-orbitrap MS (Orbitrap Fusion, Thermo Fisher Scientific) in orbitrap-orbitrap configuration ...
-
bioRxiv - Systems Biology 2024Quote: DISPA of the plasma proteome peptides was performed on an Orbitrap Fusion Lumos™ mass spectrometer (Thermo Fisher Scientific) coupled with the FAIMS Pro Interface ...
-
bioRxiv - Bioengineering 2024Quote: ... Peptides were then analysed on a Ultimate 3500 RSLCnano system (Dionex) and a Q-Exactive HF (Thermo Fisher Scientific) mass spectrometer ...
-
bioRxiv - Plant Biology 2024Quote: ... Eluting peptides were on-line ionized by nano-electrospray (nESI) using the Nanospray Flex Ion Source (Thermo Fisher Scientific) at 1.5 kV (liquid junction ...
-
bioRxiv - Microbiology 2024Quote: ... Peptides were separated using a 140 min gradient generated by an EASY-nLC 1000 liquid chromatography (Thermo Fisher Scientific) with the column heated to 50 °C by a PRSO-V1 column oven (Sonation) ...
-
bioRxiv - Cell Biology 2023Quote: The fractionated peptides were analysed by LC-MS/MS using a fully automated Ultimate 3000 RSLC nano System (ThermoFisher) fitted with a 100 μm x 2 cm PepMap100 C18 nano trap column and a 75 μm×25 cm ...
-
bioRxiv - Physiology 2024Quote: ... Approximately 7 µg of tryptic peptide from each tissue sample was labeled with TMT-Pro 16 plex (Thermo Scientific) reagents according to the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2024Quote: ... Peptide separation was performed using a reversed-phase analytical column (Acclaim PepMap RSLC, 0.075 × 250 mm (Thermo Fisher Scientific)) with a linear gradient of 4-27.5% solvent B (0.1% FA in 98% ACN ...
-
bioRxiv - Genomics 2024Quote: ... Desalted peptides were labeled with the TMT-10plex mass tag labeling reagent according to the manufacturer’s instructions (Thermo Scientific) with small modifications ...
-
bioRxiv - Neuroscience 2024Quote: ... Quantification of histone peptides were performed in nanoLC coupled online to an LTQ-Orbitrap Elite mass spectrometer (Thermo Scientific). About 1-5 μg of desalted samples were then separated using a 75 μm ID x 17 cm Reprosil-Pur C18-AQ (3 μm ...
-
bioRxiv - Biophysics 2023Quote: The PUR4 (also known as FUD) peptide (sequence: KDQSPLAGESGETEYITEVYGNQQNPVDIDKKLPNETGFSGNMVETEDT) and the scrambled control (sequence: EKGYSKPPVGNEGGDQVDEYDTMSQTKLEDEGNTLISPITFENATEQVN) were synthesised by ThermoFisher Scientific without any tags or modifications ...
-
bioRxiv - Cell Biology 2023Quote: ... The eluted peptides were sprayed into a LTQ Orbitrap Velos mass spectrometer (Thermo Fisher Scientific, San Jose, CA, USA) equipped with a nano-ESI ion source ...
-
bioRxiv - Microbiology 2023Quote: ... the peptides were resuspended in 0.1% (v/v) formic acid and desalted using C18 Zip tips (Pierce, Thermo Scientific). The peptides were again dried by vacuum centrifugation before being reconstituted in 50 µL of 0.1% (v/v ...
-
bioRxiv - Biochemistry 2024Quote: Peptide samples were dissolved in 0.1% FA and analyzed on the Orbitrap Eclipse Tribrid Mass spectrometer (Thermo Fisher Scientific) coupled to an Easy-nLC 1200 HPLC system (Thermo Fisher Scientific) ...
-
bioRxiv - Microbiology 2024Quote: ... Peptides were trapped on a C18 Acclaim PepMap 100 (5 µm, 300 µm x 5mm) trap column (ThermoFisher Scientific) and eluted onto a C18 Acclaim PepMap100 3 µm ...
-
bioRxiv - Immunology 2024Quote: TMT-labelled tryptic peptides were subjected to HpRP fractionation using an Ultimate 3000 RSLC UHPLC system (Thermo Fisher Scientific) equipped with a 2.1 mm internal diameter (ID ...
-
bioRxiv - Microbiology 2024Quote: ... We quantified the abundance of the peptides using the Pierce Micro BCA assay (Thermo Scientific Pierce, Rockford, IL, USA) following the manufacturer’s instructions.
-
bioRxiv - Bioengineering 2023Quote: The peptide digests were subjected to LC MS/MS analysis using an UltiMate 3000 RSLC system (Thermo Fisher Scientific) coupled in-line to an Orbitrap Fusion Lumos mass spectrometer (Thermo Fisher Scientific) ...
-
Ribonuclease Inhibitor and Angiogenin collaboratively regulate cell-type-specific global translationbioRxiv - Biochemistry 2024Quote: ... Peptides were trapped on a micro-precolumn C18 PepMap100 (5μm, 100 Å, 300 μm×5mm, ThermoFisher Scientific, Reinach, Switzerland) and separated by backflush onto the analytical nano-column (C18 ...
-
bioRxiv - Biochemistry 2024Quote: ... Samples were injected onto a 300μm x 5mm PepMap Neo Trap Cartridge peptide trap column (C18, 5μm particle size, 100Å pore size, ThermoFisher Scientific) and separated on an EASY-Spray 75μm x 50cm PepMap HPLC column (C18 ...
-
bioRxiv - Biochemistry 2024Quote: ... Samples were injected onto a 300μm x 5mm PepMap Neo Trap Cartridge peptide trap column (C18, 5μm particle size, 100Å pore size, ThermoFisher Scientific) and separated on an EASY-Spray 75μm x 50cm PepMap HPLC column (C18 ...
-
bioRxiv - Biochemistry 2024Quote: ... 75 µm x 50 cm) and peptides then analysed using an Orbitrap Eclipse Tribrid mass spectrometer (Thermo Fisher Scientific). Solvent A comprised 0.1% formic acid (v/v ...