Labshake search
Citations for Thermo Fisher :
301 - 350 of 10000+ citations for Caspase Recruitment Domain Family Member 17 CARD17 Antibody since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2023Quote: ... Tbet anti-mouse APC (Thermo Fisher Scientific, Catalog no. 17-5825-82), IL-17A anti-mouse Alexa Fluor 488 (BioLegend ...
-
bioRxiv - Genomics 2024Quote: PA was dissolved in HPLC grade ethanol (Fisher Scientific, 64-17-5) to a final concentration of 5mg/mL to create a stock solution ...
-
bioRxiv - Cell Biology 2024Quote: ... and CD326(aka EpCAM)-APC (ThermoFisher, clone: G8.8, cat# 17-5791-82); DAPI was used to gate out dead cells ...
-
bioRxiv - Neuroscience 2024Quote: ... HEK293T-17 cells were grown in Dulbecco’s modified Eagle’s medium (DMEM; Invitrogen) supplemented with 10% fetal bovine serum (FBS ...
-
bioRxiv - Synthetic Biology 2024Quote: ... into a 96-well round bottom plate (Fisher Scientific #08-772-17). This plate was then analyzed with a CytoFLEX flow cytometer.
-
bioRxiv - Neuroscience 2024Quote: ... Myelin was removed by 24% Percoll (Fisher Scientific, cat# 17-0891-01) and PBS density gradient centrifugation for 20 min ...
-
bioRxiv - Immunology 2020Quote: ... cells were treated with 2 mM caspase-3/7 detection reagent (Fisher Scientific) for 30 min ...
-
bioRxiv - Immunology 2020Quote: ... Apoptosis was detected using the CellEvent Caspase-3/7 Green Detection Reagent (ThermoFisher). Frames were captured over a period of 24 hrs at 1 hour intervals from 4 separate 1.75 x 1.29 mm2 regions per well with a 10× objective using IncuCyte S3 live-cell analysis system (Sartorius) ...
-
bioRxiv - Immunology 2020Quote: ... Apoptosis was detected using the CellEvent Caspase-3/7 Green Detection Reagent (ThermoFisher). Frames were captured over a period of 24hrs at 1-hour intervals from 4 separate 1.75 x 1.29 mm2 regions per well with a 10× objective using IncuCyte S3 live-cell analysis system (Sartorius) ...
-
bioRxiv - Immunology 2021Quote: ... In vitro derived PCs were stained with CellEvent Caspase 3/7-Green (ThermoFisher), tetrametylrhodamine ...
-
bioRxiv - Cell Biology 2021Quote: ... supplemented with CellEvent Caspase 3/7 Detection Reagent (ThermoFisher Scientific, cat. no. C10423) to a final concentration of 2 μM ...
-
bioRxiv - Immunology 2021Quote: ... and 8 μM of CellEvent™ Caspase-3/7 Green Detection Reagent (Invitrogen) for 30 min at 37°C 5% CO2 ...
-
bioRxiv - Cancer Biology 2023Quote: ... Cytotoxicity was assessed using the CellEvent Caspase-3/7 Green Detection Reagent (ThermoFisher) at 1.0 µM and gating on CD45-negative cells ...
-
bioRxiv - Biochemistry 2022Quote: ... and 2 µM CellEvent™ Caspase-3/7 Green Detection Reagent (ThermoFisher Scientific). Images were captured automatically every two hours for 48 hours using the IncuCyte™ S3 Live-Cell Analysis Instrument (Essen BioScience) ...
-
bioRxiv - Cell Biology 2023Quote: ... and treated with 2 µM Caspase-3/7 Green detection reagent (C10423, Invitrogen) along with the specified compounds ...
-
bioRxiv - Immunology 2022Quote: ... cells were fixed with the FOXP3 fixation and permeabilization kit and stained with antibodies against FOXP3 (FJK-16s ThermoFisher Scientific 17-5773-82, 48-5773-82), GFP (Rockland ...
-
bioRxiv - Biochemistry 2021Quote: ... The chemically synthesized p53 TAD2 domain peptide (38QAMDDLMLSPDDIEQWFTEDPGPD61) was obtained with >90% purity from Thermo Scientific, USA ...
-
bioRxiv - Molecular Biology 2021Quote: ... the gene encoding PDGFR transmembrane domain was amplified by PCR using pDisplay vector (Thermo Fisher Scientific) as a template ...
-
bioRxiv - Plant Biology 2020Quote: ... A Y2H prey library of Arabidopsis NTL proteins fused to the GAL4 activation domain (pDEST22; Invitrogen) was similarly created and transformed into the opposite yeast mating strain ...
-
bioRxiv - Developmental Biology 2020Quote: Robo1 domain deletions were generated via site-directed mutagenesis using Phusion Flash PCR MasterMix (Thermo Scientific), and completely sequenced to ensure no other mutations were introduced ...
-
bioRxiv - Bioengineering 2022Quote: ... The gene encoding PDGFR transmembrane domain was amplified by PCR using pDisplay vector (Thermo Fisher Scientific) as a template ...
-
bioRxiv - Immunology 2022Quote: Sequences for VH and VL domains were codon optimized using GeneArt (Thermo Fisher Scientific, Waltham, MA) and gene blocks for each domain were purchased from Integrated DNA Technologies (IDT ...
-
bioRxiv - Microbiology 2023Quote: ... followed by an incubation with mouse anti-human E-cad cytoplasmic domain mAb (4A2C7, Life Technologies). In some experiments ...
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Bioengineering 2023Quote: ... The novel PTGFRN transmembrane domain display systems were codon optimized and DNA synthesized by Thermo Fisher. All plasmids were sequence-verified ...
-
bioRxiv - Neuroscience 2023Quote: ... or lacking the CTLH (ΔCTLH) and LISH (ΔLISH) domain were cloned by the Gateway® (Invitrogen) method into pDONR221 entry vector and then recombined into a yeast low-copy number CEN destination vector (Addgene ...
-
bioRxiv - Genomics 2020Quote: ... MACS-purified neutrophils were then stained using APC-Ly6G (Invitrogen #17-9668-80) and Vioblue-Cd11b (Miltenyi Biotech #130-113-238 ...
-
bioRxiv - Cancer Biology 2022Quote: ... before interferon gamma (IFN-γ)-APC (Invitrogen, 17-7311-81, 1:160 dilution) staining ...
-
bioRxiv - Cell Biology 2019Quote: ... lysates were run in 17-well 4-12% Bis-Tris gels (Thermo Fisher) at 120V for 1.5 h ...
-
bioRxiv - Synthetic Biology 2019Quote: ... lactis was grown in M-17 (Oxoid, Thermo Fisher Scientific, Waltham, MA, USA) supplemented with 0.5% D-glucose (GM-17 ...
-
bioRxiv - Microbiology 2020Quote: ... as described in (17) and cloned into a pcDNA4/TO vector (ThermoFisher, V102020) using BamHI/XbaI restriction sites ...
-
bioRxiv - Molecular Biology 2022Quote: Transfection of HEK293T/17 cells was performed using Lipofectamine 2000 (Thermo Fisher Scientific) according to manufacturer’s protocol.
-
bioRxiv - Molecular Biology 2022Quote: HEK293T/17 cells were cultured in Dulbecco’s Modified Eagle’s Medium (DMEM, Gibco, USA) supplemented with 10% fetal bovine serum (FBS) ...
-
bioRxiv - Immunology 2023Quote: ... anti-CD44 (APC or PE, Invitrogen, #17-0441-82, or #12-0331-82), and anti-CD62L (APC/eFluor780 ...
-
bioRxiv - Biochemistry 2023Quote: ... and mCD19 (APC, clone eBio1D3, Invitrogen Cat No. 17-0193-80, 1:100). Cells were sorted as described in “Isolation of immune cells from peripheral human blood” ...
-
bioRxiv - Immunology 2023Quote: ... IL-10 and IL-17 were tested using cytokine measuring kits (Invitrogen, USA) following the manufacturer’s protocol ...
-
bioRxiv - Immunology 2024Quote: HEK293T/17 cells were transfected using Lipofectamine 3000 (L3000008, ThermoFisher, Waltham, MA, USA) according to the user manual ...
-
bioRxiv - Microbiology 2024Quote: ... Anti-Mouse CD172a (SIRP alpha)-APC was purchased from Invitrogen (17-1721-82). Ferroportin/ SLC40A1 antibody was purchased from Novus Biologicals (NBP2-45356) ...
-
bioRxiv - Bioengineering 2022Quote: Cell apoptosis was evaluated with CellEvent® Caspase 3/7 Green (Thermo Fisher, UK), following the manufacturer’s instructions ...
-
bioRxiv - Immunology 2022Quote: ... CellEvent Caspase-3/7 green flow cytometry assay kit was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Cell Biology 2022Quote: ... cells were treated with CellEvent caspase-3/7 green detection reagent (ThermoFisher cat # C10423) according to manufacturer’s instructions at a final concentration of 8 µM ...
-
bioRxiv - Cell Biology 2023Quote: ... flow cytometric apoptosis quantification was performed using the CellEvent Caspase 3/7 kit (ThermoFisher) following the manufacturer’s recommendations.
-
bioRxiv - Cancer Biology 2023Quote: ... supplemented with 6µM CellEvent Caspase-3/7 Green Detection Reagent (Thermofisher, #C10423, green fluorescence). Cancer cell lines (IGR-Heu and IGR-Pub ...
-
bioRxiv - Cell Biology 2023Quote: ... or CellEvent™ Caspase-3/7 Green Flow Cytometry Assay Kit (Thermo Fisher Scientific) to label apoptotic cells (Caspase-3/7 activity-positive and SytoxAADvanced-negative ...
-
bioRxiv - Cell Biology 2023Quote: ... Apoptotic cells were detected with CellEvent™ Caspase-3/7 Green Detection Reagent (Invitrogen) (1:500) ...
-
bioRxiv - Cell Biology 2024Quote: Caspase-4 – GAG ACU AUG UAA AGA AAG Att (Thermo Fisher; siRNA ID s2414)
-
bioRxiv - Cell Biology 2024Quote: Caspase-1 – CCA CUG AAA GAG UGA CUU Utt (Thermo Fisher; siRNA ID s2408)
-
bioRxiv - Immunology 2020Quote: ... followed by permeabilization using 1X permeabilization buffer (eBioscience) for 40 minutes at room temperature in the presence of the following intracellular antibodies: FoxP3 APC (clone PCH101, Invitrogen, cat# 17-4776-42, dilution 4:100); Tbet BV605 (clone 4B10 ...
-
bioRxiv - Immunology 2022Quote: ... soluble extracellular domain (ECD) of human CD58 was produced either in Freestyle 293F suspension cells (Thermo Fisher) or adherent HEK 293T cells ...
-
bioRxiv - Immunology 2021Quote: ... DNA fragments coding for their IgH and IgL variable domains were synthetized (Life Technologies, Thermo Fisher Scientific). Purified digested DNA fragments were cloned into human Igγ1- and Ig κ-/ Igλ-expressing vectors 38 and recombinant IgG1 antibodies were produced by transient co-transfection of Freestyle™ 293-F suspension cells (Thermo Fisher Scientific ...