Labshake search
Citations for Thermo Fisher :
2451 - 2500 of 5131 citations for FADD Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Genetics 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
bioRxiv - Plant Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
Lactylation-driven FTO-mediated m6A modification of CDK2 aggravates diabetic microvascular anomaliesbioRxiv - Cell Biology 2023Quote: ... Peptides were then labeled with TMT using a TMT10plex mass tag labeling kit (Thermo Fisher Scientific) per the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2023Quote: ... Peptides were trapped onto a C18 PepMac100 precolumn (300 µm i.d.x5 mm, 100 Å, ThermoFisher Scientific) using Solvent A (0.1% Formic acid ...
-
bioRxiv - Cell Biology 2023Quote: ... Peptides were labeled using 100 ug of 16-plex tandem mass tag (TMTpro) reagents (Thermo Fisher), with incubation for 60 min at 22 °C ...
-
bioRxiv - Immunology 2023Quote: ... Peptides were trapped on precolumn (PepMap100 C18 3 μm; 75 μm × 2 cm; Thermo Fisher Scientific) and separated on an EASY-Spray column (Thermo Fisher Scientific) ...
-
bioRxiv - Zoology 2023Quote: ... Peptides produced by protease digestion were separated with a Thermo UltiMate 3000 UHPLC (Thermo Fisher Scientific) using a 5–80% effective gradient with mobile phase B (98% acetone ...
-
bioRxiv - Systems Biology 2023Quote: ... The digested peptides were labeled with 11-plex TMT reagents following the manufacturer’s instructions (Thermo Scientific). MP was labeled by TMT channel 131C ...
-
bioRxiv - Systems Biology 2023Quote: ... The eluted solution containing peptides was vacuum-dried with a Savant SPD121P SpeedVac concentrator (Thermo Scientific). The digested peptides were labeled with 11-plex TMT reagents following the manufacturer’s instructions (Thermo Scientific) ...
-
bioRxiv - Plant Biology 2023Quote: ... Peptides were eluted from a 75 μm x 50 cm C18 analytical column (PepMan, Thermo Scientific) on a linear gradient running from 4 to 64% acetonitrile in 240 min and sprayed directly into the Q-Exactive mass spectrometer ...
-
bioRxiv - Plant Biology 2023Quote: ... Eluted peptides were sprayed directly into an LTQ-Orbitrap Fusion Tribrid mass spectrometer (Thermo Fisher Scientific). Scans were collected in data-dependent top-speed mode of a 3-second cycle with dynamic exclusion set at 60 sec ...
-
bioRxiv - Microbiology 2023Quote: Pooled samples were fractionated using the Pierce™ High pH Reversed-Phase Peptide Fractionation Kit (ThermoFisher Scientific ...
-
bioRxiv - Plant Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (PepMap C18 ...
-
bioRxiv - Plant Biology 2024Quote: ... The acidified tryptic peptides were desalted using C18 Tips (Thermo Fisher Scientific, 10 μL bed, 87782) and peptide samples were eluted with 0.1% formic acid and analysed on an Orbitrap Elite instrument (ThermoFisher Scientific ...
-
bioRxiv - Cell Biology 2024Quote: ... Peptides were gradient eluted directly to an Orbitrap Q Exactive HF-X mass spectrometer (Thermo Fisher) using a 95 min acetonitrile gradient from 5 to 35 % B in 60 min followed by a ramp to 45% B in 10 min and 100% B in another 10 min with a hold at 100% B for 10 min (A=2% acetonitrile in 0.5% acetic acid ...
-
bioRxiv - Systems Biology 2024Quote: ... The peptide separation was carried out using a Proxeon EASY nLC 1200 System (Thermo Fisher Scientific) fitted with a custom-made C18 column (15 cm x 150 μm ID ...
-
bioRxiv - Systems Biology 2024Quote: ... The peptides were analyzed by an Exploris240 Orbitrap mass spectrometer (Thermo Fisher Scientific, Waltham, United States). The peptides were subjected to nanospray ion source followed by MS/MS in Exploris240 coupled online to the nano-LC ...
-
bioRxiv - Neuroscience 2024Quote: Peptides extracted from CSF were analyzed with an Orbitrap Q-Exactive HF mass spectrometer (Thermo Scientific) coupled with an online Easy-nLC 1200 nano-HPLC system (Thermo Scientific) ...
-
bioRxiv - Biochemistry 2024Quote: Peptide identification and TMT-based protein quantification was performed in Proteome Discoverer 2.4 (PD, Thermo Fisher). MS/MS spectra were searched using SEQUEST-HT against a Uniprot human proteome database (released 03/2014 and containing 20,337 entries ...
-
bioRxiv - Biochemistry 2024Quote: ... Peptide samples were then reacted with tandem mass tag (TMT) 16/18-plex reagents (Thermo Fisher) in 40% vol/vol acetonitrile and incubated for 1 hour at room temperature ...
-
bioRxiv - Molecular Biology 2023Quote: Phosphopeptides were then fractionated using a Pierce high pH reverse-phase peptide fractionation kit (Thermo Fisher) based on (38) ...
-
bioRxiv - Biophysics 2023Quote: ... peptides were loaded onto a C18 analytical column (1 mm i.d. × 50 mm, Thermo Fisher Scientific) connected to an Agilent 1290 Infinity II UHPLC system ...
-
bioRxiv - Biochemistry 2023Quote: ... Peptide samples were dissolved in 0.1% (v/v) formic acid (FA, Thermo Fisher Scientific, LS118-4) for MS analysis ...
-
bioRxiv - Biochemistry 2023Quote: ... Aliquots containing 10 μg of digested peptides were cleaned using PierceTM C18 Spin Tips (Thermo Scientific) according to the manufacturer’s protocol ...
-
bioRxiv - Developmental Biology 2023Quote: ... Separated peptides were electrosprayed and analyzed using a Q-Exactive HF mass spectrometer (Thermo Fisher Scientific), operated in positive polarity in a datadependent mode ...
-
bioRxiv - Immunology 2023Quote: ... Peptides were loaded on a trap column (Acclaim PepMap 100, 100 µm x 2cm, Thermo Scientific) using combined control with a loading volume of 20 µL ...
-
bioRxiv - Molecular Biology 2023Quote: ... Tryptic peptide analysis was performed using an Orbitrap Fusion Lumos Tribid mass spectrometer (Thermo Fisher Scientific) interfaced with an Ultimate 3000 Nano-HPLC (Thermo Fisher Scientific) ...
-
bioRxiv - Biochemistry 2023Quote: ... 48 h after the peptide treatment 10 % (v/v) of alamarBlue reagent (Thermo Fisher Scientific, #DAL1100) was added to each well and incubated for 4 h at 37°C ...
-
bioRxiv - Microbiology 2023Quote: ... Peptides were analyzed on a Q Exactive apparatus with an EASY nanospray source (Thermo Fisher Scientific) at an electrospray potential of 1.5 kV ...
-
bioRxiv - Cancer Biology 2023Quote: ... The peptides from each sample were labeled with individual Tandem Mass Tags (TMT) (Thermo Fisher Scientific) as previously described50 ...
-
bioRxiv - Microbiology 2024Quote: ... Peptide separation was carried out using an Ultimate 3000 nanoLC-system (Thermo Fisher Scientific, Waltham, USA), equipped with an in-house packed C18 resin column (Magic C18 AQ 2.4 µm ...
-
bioRxiv - Microbiology 2024Quote: ... and peptides were labeled using TMTpro 18-plex isobaric mass tagging reagents (Thermo Fisher Scientific, #A52045) according to the manufactureŕs instructions ...
-
bioRxiv - Immunology 2023Quote: ... Eluting peptides were injected directly into the mass spectrometer using an EASY-Spray source (Thermo Scientific). The instrument was operated in data-dependent mode with parent ion scans (MS1 ...
-
bioRxiv - Plant Biology 2024Quote: ... Final peptide concentrations were determined using a bicinchoninic acid (BCA) assay (Thermo Scientific, Waltham, MA USA) and each sample was prepared at 0.1 µg/µl for MS analysis Digested protein samples were analyzed using an Orbitrap Eclipse Tribrid MS (Thermo Scientific ...
-
bioRxiv - Cell Biology 2024Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 200 cm µPAC column (PharmaFluidics ...
-
bioRxiv - Cell Biology 2024Quote: ... Phosphorylated peptides were enriched either using the High-Select Fe-NTA Phosphopeptide Enrichment Kit (Thermo Scientific) or the Titansphere Phos-TiO Kit (GL Science ...
-
bioRxiv - Molecular Biology 2024Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 200 cm µPAC column (PharmaFluidics) ...
-
bioRxiv - Developmental Biology 2024Quote: ... and serially diluted with enzyme buffer before ATP and fluorescein-conjugated PKC substrate peptide (ThermoFisher Scientific) were added and incubated ...
-
bioRxiv - Molecular Biology 2024Quote: ... eluted peptides were analyzed on a Q Exactive HF-X Orbitrap mass spectrometer (Thermo-Fisher Scientific), which was coupled to the column with a customized nano-spray EASY-Spray ion source (Thermo-Fisher Scientific ...
-
bioRxiv - Neuroscience 2024Quote: ... The eluted peptides were further injected into an Orbitrap Exploris 480 (Thermo Fisher Scientific, Bremen, Germany), where MS1 scans were acquired in the range of 300–1700 m/z and with a maximum injection time of 40 ms ...
-
bioRxiv - Neuroscience 2024Quote: ... The eluted peptides were further injected into a QExactive HF-X (Thermo Fisher Scientific, Bremen, Germany), operated in data-dependent acquisition mode alternating between MS and MS2 acquisitions ...
-
bioRxiv - Neuroscience 2024Quote: ... The eluted peptides were further injected into an Orbitrap Exploris 480 (Thermo Fisher Scientific, Bremen, Germany), which was operated in targeted mass acquisition mode switching between MS1 and targeted MS2 scans ...
-
bioRxiv - Molecular Biology 2024Quote: ... The digested peptides were analyzed with an EASY nano-LC 1200 system (Thermo Scientific, Milano, Italy) coupled to a 5600+ TripleTOF system (AB Sciex ...
-
bioRxiv - Microbiology 2024Quote: ... Peptide separation was carried out using an Ultimate 3000 nanoLC-system (Thermo Fisher Scientific, Waltham, USA), equipped with an in-house packed C18 resin column (Magic C18 AQ 2.4 µm ...
-
bioRxiv - Systems Biology 2024Quote: ... Cross-linked peptides from SCX fractions were further enriched using UltraLink monomeric avidin (Thermo Fisher Scientific). The enriched cross-linked peptide sample was concentrated by vacuum centrifugation and stored at -80 °C.
-
bioRxiv - Microbiology 2024Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 200 cm µPAC column (PharmaFluidics) ...
-
bioRxiv - Cell Biology 2020Quote: ... were blocked (5% nonfat milk) prior to incubation with primary antibodies diluted in Superblock blocking reagent (Thermo Scientific). Binding was detected by incubation with HRP coupled secondary antibodies (1:10000 ...
-
bioRxiv - Developmental Biology 2021Quote: ... the cells were incubated with secondary antibodies (1: 500 dilution in blocking buffer, Alexa Fluor 488, Life Technologies) at room temperature for 1 hour in the dark ...
-
bioRxiv - Neuroscience 2021Quote: ... and primary antibodies applied overnight in blocking medium (Cx36, Thermofisher 51-6300, RRID: AB_2533913, 1:1000; NMDAR1, Thermofisher 32-0500 ...