Labshake search
Citations for Thermo Fisher :
2401 - 2450 of 5129 citations for RAB15 Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Plant Biology 2024Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
bioRxiv - Molecular Biology 2024Quote: ... Peptide samples were injected for analysis using a nano flow HPLC (RSLC U3000, Thermo Fisher Scientific) coupled to a mass spectrometer equipped with a nanoelectrospray source (Q Exactive HF ...
-
bioRxiv - Plant Biology 2024Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, ThermoFisher, US) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
bioRxiv - Neuroscience 2023Quote: ... Secreted Aβ42 peptides were quantified using the Human Amyloid β1-42 human ELISA kit (Thermo Fisher) according to the manufacturer’s protocol ...
-
bioRxiv - Cell Biology 2024Quote: Pre-fractionated TMT-labeled peptides were analyzed on a Fusion Lumos mass spectrometer (Thermo Fisher Scientific) equipped with a Thermo EASY-nLC 1200 LC system (Thermo Fisher Scientific) ...
-
bioRxiv - Immunology 2024Quote: ... Peptide loaded monomers were subsequently conjugated into tetramers using R-PE streptavidin (ThermoFisher Scientific, Waltham, MA) or fluorochromes of interest at a molar ratio of 8:1 ...
-
bioRxiv - Cell Biology 2024Quote: ... Peptic peptides were identified using an in-house Proteome Discoverer (Version PD1.4, Thermo-Fisher Scientific, USA).
-
bioRxiv - Microbiology 2024Quote: ... the digested peptides were analyzed on an Orbitrap Q Exactive HF mass spectrometer (Thermo Fisher Scientific) equipped with an EASY-nLC 1200 system (Thermo Fisher Scientific) ...
-
bioRxiv - Microbiology 2023Quote: Desalted peptides were separated on an UltiMate 3000 RSLCnano high-performance nano-UPLC system (Thermo Scientific) coupled to an Orbitrap Fusion Tribrid mass spectrometer (Thermo Scientific ...
-
bioRxiv - Immunology 2023Quote: Analysis of peptide readout was performed on a Q Exactive™ plus Mass Spectrometer (Thermo Scientific) coupled to a Dionex Ultimate 3000 RS (Thermo Scientific) ...
-
bioRxiv - Microbiology 2023Quote: ... Peptide concentrations were measured using the Invitrogen Qubit protein assay kit (Thermo Fisher Scientific, Darmstadt, Germany).
-
bioRxiv - Systems Biology 2023Quote: ... and peptides were released by PNGaseF (BioConcept AG) on the Versette liquid handling robot (ThermoFisher Scientific). The unbound samples were used for the assessment of silencing efficiency ...
-
bioRxiv - Plant Biology 2023Quote: ... the acidified tryptic peptides were desalted using C18 Tips (Thermo Fisher Scientific, 10 μL bed, 87782) and peptide samples were resuspended in 0.1% FA solution and analysed on an Orbitrap Elite instrument (ThermoFisher Scientific ...
-
Cancer-associated fibroblasts produce matrix-bound vesicles that influence endothelial cell functionbioRxiv - Cancer Biology 2023Quote: Eluting peptides were electrosprayed into the mass spectrometer using a nanoelectrospray ion source (Thermo Fisher Scientific). An Active Background Ion Reduction Device (ABIRD ...
-
bioRxiv - Genomics 2023Quote: ... 100 µg of tryptic peptides from each sample were used for the TMTpro reagent (ThermoFisher Scientific) labeling procedure according to the manufacturer’s protocol ...
-
bioRxiv - Biochemistry 2023Quote: ... Samples were fractionated using the Pierce™ High pH Reversed-Phase Peptide Fractionation Kit (ThermoFisher Scientific) into 3 fractions (Fraction No ...
-
bioRxiv - Microbiology 2022Quote: ... Peptides were analysed by online nanoLC-MS/MS (UltiMate 3000 RSLCnano and QExactive Plus, Thermo Scientific) with 2 replicates per sample ...
-
bioRxiv - Molecular Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (PepMap C18 ...
-
bioRxiv - Molecular Biology 2023Quote: ... Eluted peptides were injected and analyzed on an Orbitrap Fusion Tribrid mass spectrometer (Thermo Fisher Scientific) controlled by the Xcalibur software (version 4.4.16.14 ...
-
bioRxiv - Microbiology 2022Quote: ... and then elution was performed with 1 mg/mL HA synthetic peptide (Cat# 26184, Thermo Fisher) per the manufacturer’s instructions ...
-
bioRxiv - Neuroscience 2023Quote: ... Peptides were separated onto a 300 μm × 5 mm PepMap C18 trapping column (Thermo Scientific, Lithuania) followed by DNV PepMap Neo 75umx150mm analytical column (Thermo Scientific ...
-
bioRxiv - Molecular Biology 2023Quote: ... The mixture was then desalted with a Pierce™ Peptide Desalting Spin Column (Thermo Fisher Scientific). Fluorescently labelled DPRs were protected from light and stored at -80°C.
-
bioRxiv - Molecular Biology 2023Quote: ... Peptides were desalted on-line using a trap column (C18 Pepmap100, 5μm, 300μmÅ∼5mm (Thermo Scientific) and then separated using 120min RP gradient (5−45% acetonitrile/0.1% formic acid ...
-
bioRxiv - Systems Biology 2023Quote: ... was mixed with iRT peptides (Biognosys) and analyzed using an Orbitrap Q-Exactive HF (ThermoFisher Scientific). An unscheduled parallel reaction monitoring (PRM ...
-
bioRxiv - Cell Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
bioRxiv - Cell Biology 2023Quote: All peptide samples were separated with an online nanoflow Proxeon EASY-nLC system (Thermo Fisher Scientific) and analyzed on an Orbitrap Lumos mass spectrometer (Thermo Fisher Scientific) ...
-
bioRxiv - Cell Biology 2023Quote: ... Peptides separated by LC were introduced into the Q Exactive HF Orbitrap mass spectrometer (ThermoFisher Scientific) using positive electrospray ionization at 2000 V and capillary temperature of 275°C ...
-
bioRxiv - Neuroscience 2023Quote: ... The eluting peptides were analyzed on a Quadrupole Orbitrap hybrid mass spectrometer (QExactive; Thermo Fisher Scientific). Here ...
-
bioRxiv - Plant Biology 2023Quote: Peptide and phosphopeptide samples were analyzed by LC-MS/MS on an RSLCnano system (ThermoFisher Scientific) coupled to a Q-Exactive HF mass spectrometer (ThermoFisher Scientific) ...
-
bioRxiv - Microbiology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
bioRxiv - Cell Biology 2023Quote: Peptides were separated on a 50 cm column composed of C18 stationary phase (Thermo Fisher ES903) using a gradient from 5% to 30% B over 2hr (Buffer A ...
-
bioRxiv - Cancer Biology 2023Quote: ... Peptides eluting from the column were analyzed using a Q Exactive HF-X (Thermo Fisher Scientific) for DIA-MS ...
-
bioRxiv - Biochemistry 2023Quote: ... The peptides eluted from the column were analyzed on an Orbitrap Exploris 480 (Thermo Fisher Scientific) using the InSpIon system (AMR ...
-
bioRxiv - Developmental Biology 2023Quote: ... Peptide desalting was performed according to the manufacturer’s instructions (Pierce C18 Tips, Thermo Scientific, Waltham, MA). Desalted peptides were reconstituted in 0.1% formic acid in water and further separated into four fractions by strong cation exchange chromatography (SCX ...
-
bioRxiv - Microbiology 2023Quote: ... Determination of phosphorylated sites in peptides was performed using Proteome Discoverer ver 1.3 (Thermo Fisher Scientific).
-
bioRxiv - Systems Biology 2023Quote: ... 1 µg of peptides was injected into a reverse phase column (EASY-SprayTM - ES902 - Thermo Scientific: 25cm x 75 µm ID ...
-
bioRxiv - Microbiology 2023Quote: The proteomic analysis of peptides was performed using Ultimate 3000 RSLCnano HPLC system (Thermo Scientific, USA), connected to the Q-exact HFX mass spectrometer (Thermo Scientific ...
-
bioRxiv - Plant Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Aurora Generation 2 ...
-
bioRxiv - Molecular Biology 2023Quote: ... Tryptic peptides were labeled using a tandem mass tag 10-plex isobaric label reagent set (ThermoFisher) following the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2023Quote: Tryptic peptides were separated using an Ultimate 3000 RSLCnano LC system (Thermo Fisher Scientific; Waltham, US) equipped with a PEPMAP100 C18 5 µm 0.3 x 5 mm trap (Thermo Fisher Scientific ...
-
bioRxiv - Biochemistry 2023Quote: ... the peptide concentration in samples was estimated using a Micro BCATM Protein Assay (Thermo Scientific, #23235), and a volume corresponding to 25 μg peptides was transferred to a new low-bind Eppendorf tube per sample ...
-
bioRxiv - Biochemistry 2023Quote: ... Crosslinked peptides were analyzed on an Orbitrap Fusion Lumos mass spectrometer (Thermo Scientific, San Jose, CA) coupled to a Dionex UltiMate 3000 RSCLnano System ...
-
bioRxiv - Biochemistry 2023Quote: Isobaric labelling of peptides was performed using TMTpro™ 16plex Label Reagent Set (Fisher Scientific, UK) according to the manufacturer’s recommended protocol (lot number ...
-
bioRxiv - Biochemistry 2022Quote: ... Peptides were ionized via electrospray ionization and analyzed by Orbitrap Eclipse and QExactive HFX (Thermo Fisher) mass spectrometer ...
-
bioRxiv - Cell Biology 2023Quote: ... Mass spectrometric analysis of eluting peptides was conducted on an Orbitrap Exploris 480 (Thermo Fisher Scientific) instrument platform with a spray voltage of 1.8 kV ...
-
bioRxiv - Cell Biology 2022Quote: ... Separated peptides were electrosprayed and analyzed using a Q-Exactive HF mass spectrometer (Thermo Fisher Scientific), operated in positive polarity in a data-dependent mode ...
-
bioRxiv - Cell Biology 2023Quote: ... and the resultant tryptic peptides were labeled with acetonitrile-dissolved TMT reagents (Thermo Scientific, Rockford, IL), and equal amounts of labeled samples were mixed before prefractionation with reversed phase (RP)-high performance liquid chromatography (HPLC) ...
-
bioRxiv - Cell Biology 2023Quote: Immunoprecipitated protein complex beads were digested into peptides using 500ng sequencing grade trypsin (Thermo Fisher Scientific) and incubated overnight at 37°C on a shaker ...
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Genetics 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...