Labshake search
Citations for Thermo Fisher :
2251 - 2300 of 4767 citations for PLXDC1 Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2023Quote: ... the peptide concentration in samples was estimated using a Micro BCATM Protein Assay (Thermo Scientific, #23235), and a volume corresponding to 25 μg peptides was transferred to a new low-bind Eppendorf tube per sample ...
-
bioRxiv - Biochemistry 2023Quote: ... Crosslinked peptides were analyzed on an Orbitrap Fusion Lumos mass spectrometer (Thermo Scientific, San Jose, CA) coupled to a Dionex UltiMate 3000 RSCLnano System ...
-
bioRxiv - Biochemistry 2023Quote: Isobaric labelling of peptides was performed using TMTpro™ 16plex Label Reagent Set (Fisher Scientific, UK) according to the manufacturer’s recommended protocol (lot number ...
-
bioRxiv - Biochemistry 2022Quote: ... Peptides were ionized via electrospray ionization and analyzed by Orbitrap Eclipse and QExactive HFX (Thermo Fisher) mass spectrometer ...
-
bioRxiv - Cell Biology 2023Quote: ... Mass spectrometric analysis of eluting peptides was conducted on an Orbitrap Exploris 480 (Thermo Fisher Scientific) instrument platform with a spray voltage of 1.8 kV ...
-
bioRxiv - Cell Biology 2022Quote: ... Separated peptides were electrosprayed and analyzed using a Q-Exactive HF mass spectrometer (Thermo Fisher Scientific), operated in positive polarity in a data-dependent mode ...
-
bioRxiv - Cell Biology 2023Quote: ... and the resultant tryptic peptides were labeled with acetonitrile-dissolved TMT reagents (Thermo Scientific, Rockford, IL), and equal amounts of labeled samples were mixed before prefractionation with reversed phase (RP)-high performance liquid chromatography (HPLC) ...
-
bioRxiv - Cell Biology 2023Quote: Immunoprecipitated protein complex beads were digested into peptides using 500ng sequencing grade trypsin (Thermo Fisher Scientific) and incubated overnight at 37°C on a shaker ...
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Genetics 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
bioRxiv - Plant Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
Lactylation-driven FTO-mediated m6A modification of CDK2 aggravates diabetic microvascular anomaliesbioRxiv - Cell Biology 2023Quote: ... Peptides were then labeled with TMT using a TMT10plex mass tag labeling kit (Thermo Fisher Scientific) per the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2023Quote: ... Peptides were trapped onto a C18 PepMac100 precolumn (300 µm i.d.x5 mm, 100 Å, ThermoFisher Scientific) using Solvent A (0.1% Formic acid ...
-
bioRxiv - Cell Biology 2023Quote: ... Peptides were labeled using 100 ug of 16-plex tandem mass tag (TMTpro) reagents (Thermo Fisher), with incubation for 60 min at 22 °C ...
-
bioRxiv - Immunology 2023Quote: ... Peptides were trapped on precolumn (PepMap100 C18 3 μm; 75 μm × 2 cm; Thermo Fisher Scientific) and separated on an EASY-Spray column (Thermo Fisher Scientific) ...
-
bioRxiv - Zoology 2023Quote: ... Peptides produced by protease digestion were separated with a Thermo UltiMate 3000 UHPLC (Thermo Fisher Scientific) using a 5–80% effective gradient with mobile phase B (98% acetone ...
-
bioRxiv - Systems Biology 2023Quote: ... The digested peptides were labeled with 11-plex TMT reagents following the manufacturer’s instructions (Thermo Scientific). MP was labeled by TMT channel 131C ...
-
bioRxiv - Systems Biology 2023Quote: ... The eluted solution containing peptides was vacuum-dried with a Savant SPD121P SpeedVac concentrator (Thermo Scientific). The digested peptides were labeled with 11-plex TMT reagents following the manufacturer’s instructions (Thermo Scientific) ...
-
bioRxiv - Plant Biology 2023Quote: ... Peptides were eluted from a 75 μm x 50 cm C18 analytical column (PepMan, Thermo Scientific) on a linear gradient running from 4 to 64% acetonitrile in 240 min and sprayed directly into the Q-Exactive mass spectrometer ...
-
bioRxiv - Plant Biology 2023Quote: ... Eluted peptides were sprayed directly into an LTQ-Orbitrap Fusion Tribrid mass spectrometer (Thermo Fisher Scientific). Scans were collected in data-dependent top-speed mode of a 3-second cycle with dynamic exclusion set at 60 sec ...
-
bioRxiv - Microbiology 2023Quote: Pooled samples were fractionated using the Pierce™ High pH Reversed-Phase Peptide Fractionation Kit (ThermoFisher Scientific ...
-
bioRxiv - Plant Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (PepMap C18 ...
-
bioRxiv - Plant Biology 2024Quote: ... The acidified tryptic peptides were desalted using C18 Tips (Thermo Fisher Scientific, 10 μL bed, 87782) and peptide samples were eluted with 0.1% formic acid and analysed on an Orbitrap Elite instrument (ThermoFisher Scientific ...
-
bioRxiv - Cell Biology 2024Quote: ... Peptides were gradient eluted directly to an Orbitrap Q Exactive HF-X mass spectrometer (Thermo Fisher) using a 95 min acetonitrile gradient from 5 to 35 % B in 60 min followed by a ramp to 45% B in 10 min and 100% B in another 10 min with a hold at 100% B for 10 min (A=2% acetonitrile in 0.5% acetic acid ...
-
bioRxiv - Systems Biology 2024Quote: ... The peptide separation was carried out using a Proxeon EASY nLC 1200 System (Thermo Fisher Scientific) fitted with a custom-made C18 column (15 cm x 150 μm ID ...
-
bioRxiv - Systems Biology 2024Quote: ... The peptides were analyzed by an Exploris240 Orbitrap mass spectrometer (Thermo Fisher Scientific, Waltham, United States). The peptides were subjected to nanospray ion source followed by MS/MS in Exploris240 coupled online to the nano-LC ...
-
bioRxiv - Neuroscience 2024Quote: Peptides extracted from CSF were analyzed with an Orbitrap Q-Exactive HF mass spectrometer (Thermo Scientific) coupled with an online Easy-nLC 1200 nano-HPLC system (Thermo Scientific) ...
-
bioRxiv - Biochemistry 2024Quote: Peptide identification and TMT-based protein quantification was performed in Proteome Discoverer 2.4 (PD, Thermo Fisher). MS/MS spectra were searched using SEQUEST-HT against a Uniprot human proteome database (released 03/2014 and containing 20,337 entries ...
-
bioRxiv - Biochemistry 2024Quote: ... Peptide samples were then reacted with tandem mass tag (TMT) 16/18-plex reagents (Thermo Fisher) in 40% vol/vol acetonitrile and incubated for 1 hour at room temperature ...
-
bioRxiv - Molecular Biology 2023Quote: Phosphopeptides were then fractionated using a Pierce high pH reverse-phase peptide fractionation kit (Thermo Fisher) based on (38) ...
-
bioRxiv - Molecular Biology 2023Quote: ... eluting peptides were analyzed on a Q Exactive HF-X Orbitrap mass spectrometer (Thermo-Fisher Scientific), which was coupled to the column with a customized nano-spray EASY-Spray ion source (Thermo-Fisher Scientific ...
-
bioRxiv - Biophysics 2023Quote: ... peptides were loaded onto a C18 analytical column (1 mm i.d. × 50 mm, Thermo Fisher Scientific) connected to an Agilent 1290 Infinity II UHPLC system ...
-
bioRxiv - Biochemistry 2023Quote: ... Peptide samples were dissolved in 0.1% (v/v) formic acid (FA, Thermo Fisher Scientific, LS118-4) for MS analysis ...
-
bioRxiv - Biochemistry 2023Quote: ... Aliquots containing 10 μg of digested peptides were cleaned using PierceTM C18 Spin Tips (Thermo Scientific) according to the manufacturer’s protocol ...
-
bioRxiv - Developmental Biology 2023Quote: ... Separated peptides were electrosprayed and analyzed using a Q-Exactive HF mass spectrometer (Thermo Fisher Scientific), operated in positive polarity in a datadependent mode ...
-
bioRxiv - Immunology 2023Quote: ... Peptides were loaded on a trap column (Acclaim PepMap 100, 100 µm x 2cm, Thermo Scientific) using combined control with a loading volume of 20 µL ...
-
bioRxiv - Molecular Biology 2023Quote: ... Tryptic peptide analysis was performed using an Orbitrap Fusion Lumos Tribid mass spectrometer (Thermo Fisher Scientific) interfaced with an Ultimate 3000 Nano-HPLC (Thermo Fisher Scientific) ...
-
bioRxiv - Biochemistry 2023Quote: ... 48 h after the peptide treatment 10 % (v/v) of alamarBlue reagent (Thermo Fisher Scientific, #DAL1100) was added to each well and incubated for 4 h at 37°C ...
-
bioRxiv - Microbiology 2023Quote: ... Peptides were analyzed on a Q Exactive apparatus with an EASY nanospray source (Thermo Fisher Scientific) at an electrospray potential of 1.5 kV ...
-
bioRxiv - Cancer Biology 2023Quote: ... The peptides from each sample were labeled with individual Tandem Mass Tags (TMT) (Thermo Fisher Scientific) as previously described50 ...
-
bioRxiv - Microbiology 2024Quote: ... Peptide separation was carried out using an Ultimate 3000 nanoLC-system (Thermo Fisher Scientific, Waltham, USA), equipped with an in-house packed C18 resin column (Magic C18 AQ 2.4 µm ...
-
bioRxiv - Microbiology 2024Quote: ... and peptides were labeled using TMTpro 18-plex isobaric mass tagging reagents (Thermo Fisher Scientific, #A52045) according to the manufactureŕs instructions ...
-
bioRxiv - Immunology 2023Quote: ... Eluting peptides were injected directly into the mass spectrometer using an EASY-Spray source (Thermo Scientific). The instrument was operated in data-dependent mode with parent ion scans (MS1 ...
-
bioRxiv - Molecular Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 200 cm µPAC column (PharmaFluidics) ...
-
bioRxiv - Immunology 2023Quote: Analysis of peptide readout was performed on a Q Exactive™ plus Mass Spectrometer (Thermo Scientific) coupled to a Dionex Ultimate 3000 RS (Thermo Scientific) ...
-
bioRxiv - Microbiology 2023Quote: ... Peptide concentrations were measured using the Invitrogen Qubit protein assay kit (Thermo Fisher Scientific, Darmstadt, Germany).
-
bioRxiv - Developmental Biology 2024Quote: ... The peptides were then introduced into an Orbitrap Exploris™ 480 mass spectrometer (Thermo Fisher Scientific) via a nanoelectrospray source ...
-
bioRxiv - Plant Biology 2024Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
bioRxiv - Molecular Biology 2024Quote: ... Peptide samples were injected for analysis using a nano flow HPLC (RSLC U3000, Thermo Fisher Scientific) coupled to a mass spectrometer equipped with a nanoelectrospray source (Q Exactive HF ...
-
bioRxiv - Plant Biology 2024Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, ThermoFisher, US) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...