Labshake search
Citations for Thermo Fisher :
1801 - 1850 of 10000+ citations for RFamide Related Peptide 1 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2022Quote: ... Individually labelled samples were combined and desalted using a Pierce Peptide Desalting Column (Thermo Scientific 89851). Labelled peptides were dried and used for Sequential Enrichment with Metal Oxide Affinity Chromatography (SMOAC) ...
-
bioRxiv - Neuroscience 2022Quote: ... the monomeric peptide was diluted to 400 μl (100 μM final concentration) in Neurobasal medium (GIBCO) and incubated for 48 hours at 4° C with rocking ...
-
bioRxiv - Cancer Biology 2022Quote: ... Peptide fractions were analyzed on a quadrupole Orbitrap mass spectrometer (Q Exactive Plus, Thermo Fisher Scientific) equipped with a UHPLC system (EASY-nLC 1000 ...
-
bioRxiv - Neuroscience 2022Quote: ... Acidified eluted peptides were analyzed on a Q Exactive HF-X mass spectrometer (Thermo Fisher Scientific) online coupled to an UItimate 3000 RSLC nano-HPLC (Dionex) ...
-
bioRxiv - Molecular Biology 2022Quote: ... Peptides were identified using tandem MS (MS/MS) with an Orbitrap mass spectrometer (Q Exactive, ThermoFisher). Product ion spectra were acquired in data-dependent mode with the top five most abundant ions selected for the product ion analysis per scan event ...
-
bioRxiv - Synthetic Biology 2022Quote: ... Peptide separation was carried out using an Ultimate 3000 nanoLC-system (Thermo Fisher Scientific, Waltham, USA), equipped with an in-house packed C18 resin column (Magic C18 AQ 2.4 µm ...
-
bioRxiv - Systems Biology 2022Quote: ... The peptide mixes were analysed using a LTQ-Orbitrap Velos Pro mass spectrometer (Thermo Fisher Scientific) coupled to an EasyLC (Thermo Fisher Scientific) ...
-
bioRxiv - Microbiology 2022Quote: ... Tryptic peptides were resolved by nanoflow high performance liquid chromatography (HPLC; Easy-nLC II, Thermo Scientific) coupled to an LTQ XL-Orbitrap hybrid mass spectrometer (Thermo Scientific) ...
-
bioRxiv - Cell Biology 2022Quote: Peptide fractions were analyzed on a quadrupole Orbitrap mass spectrometer (Q Exactive Plus, Thermo Fisher Scientific) equipped with a UHPLC system (EASY-nLC 1000 ...
-
bioRxiv - Systems Biology 2023Quote: ... and peptides were released by PNGaseF (BioConcept AG) on the Versette liquid handling robot (ThermoFisher Scientific). The unbound samples were used for the assessment of silencing efficiency ...
-
bioRxiv - Plant Biology 2023Quote: ... the acidified tryptic peptides were desalted using C18 Tips (Thermo Fisher Scientific, 10 μL bed, 87782) and peptide samples were resuspended in 0.1% FA solution and analysed on an Orbitrap Elite instrument (ThermoFisher Scientific ...
-
Cancer-associated fibroblasts produce matrix-bound vesicles that influence endothelial cell functionbioRxiv - Cancer Biology 2023Quote: Eluting peptides were electrosprayed into the mass spectrometer using a nanoelectrospray ion source (Thermo Fisher Scientific). An Active Background Ion Reduction Device (ABIRD ...
-
bioRxiv - Genomics 2023Quote: ... 100 µg of tryptic peptides from each sample were used for the TMTpro reagent (ThermoFisher Scientific) labeling procedure according to the manufacturer’s protocol ...
-
bioRxiv - Biochemistry 2023Quote: ... Samples were fractionated using the Pierce™ High pH Reversed-Phase Peptide Fractionation Kit (ThermoFisher Scientific) into 3 fractions (Fraction No ...
-
bioRxiv - Microbiology 2022Quote: ... Peptides were analysed by online nanoLC-MS/MS (UltiMate 3000 RSLCnano and QExactive Plus, Thermo Scientific) with 2 replicates per sample ...
-
bioRxiv - Molecular Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (PepMap C18 ...
-
bioRxiv - Molecular Biology 2023Quote: ... Eluted peptides were injected and analyzed on an Orbitrap Fusion Tribrid mass spectrometer (Thermo Fisher Scientific) controlled by the Xcalibur software (version 4.4.16.14 ...
-
bioRxiv - Neuroscience 2023Quote: ... Peptides were separated onto a 300 μm × 5 mm PepMap C18 trapping column (Thermo Scientific, Lithuania) followed by DNV PepMap Neo 75umx150mm analytical column (Thermo Scientific ...
-
bioRxiv - Molecular Biology 2023Quote: ... The mixture was then desalted with a Pierce™ Peptide Desalting Spin Column (Thermo Fisher Scientific). Fluorescently labelled DPRs were protected from light and stored at -80°C.
-
bioRxiv - Molecular Biology 2023Quote: ... Peptides were desalted on-line using a trap column (C18 Pepmap100, 5μm, 300μmÅ∼5mm (Thermo Scientific) and then separated using 120min RP gradient (5−45% acetonitrile/0.1% formic acid ...
-
bioRxiv - Systems Biology 2023Quote: ... was mixed with iRT peptides (Biognosys) and analyzed using an Orbitrap Q-Exactive HF (ThermoFisher Scientific). An unscheduled parallel reaction monitoring (PRM ...
-
bioRxiv - Cell Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
bioRxiv - Cell Biology 2023Quote: All peptide samples were separated with an online nanoflow Proxeon EASY-nLC system (Thermo Fisher Scientific) and analyzed on an Orbitrap Lumos mass spectrometer (Thermo Fisher Scientific) ...
-
bioRxiv - Cell Biology 2023Quote: ... Peptides separated by LC were introduced into the Q Exactive HF Orbitrap mass spectrometer (ThermoFisher Scientific) using positive electrospray ionization at 2000 V and capillary temperature of 275°C ...
-
bioRxiv - Neuroscience 2023Quote: ... The eluting peptides were analyzed on a Quadrupole Orbitrap hybrid mass spectrometer (QExactive; Thermo Fisher Scientific). Here ...
-
bioRxiv - Plant Biology 2023Quote: Peptide and phosphopeptide samples were analyzed by LC-MS/MS on an RSLCnano system (ThermoFisher Scientific) coupled to a Q-Exactive HF mass spectrometer (ThermoFisher Scientific) ...
-
bioRxiv - Microbiology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
bioRxiv - Cell Biology 2023Quote: Peptides were separated on a 50 cm column composed of C18 stationary phase (Thermo Fisher ES903) using a gradient from 5% to 30% B over 2hr (Buffer A ...
-
bioRxiv - Cancer Biology 2023Quote: ... Peptides eluting from the column were analyzed using a Q Exactive HF-X (Thermo Fisher Scientific) for DIA-MS ...
-
bioRxiv - Biochemistry 2023Quote: ... The peptides eluted from the column were analyzed on an Orbitrap Exploris 480 (Thermo Fisher Scientific) using the InSpIon system (AMR ...
-
bioRxiv - Developmental Biology 2023Quote: ... Peptide desalting was performed according to the manufacturer’s instructions (Pierce C18 Tips, Thermo Scientific, Waltham, MA). Desalted peptides were reconstituted in 0.1% formic acid in water and further separated into four fractions by strong cation exchange chromatography (SCX ...
-
bioRxiv - Microbiology 2023Quote: ... Determination of phosphorylated sites in peptides was performed using Proteome Discoverer ver 1.3 (Thermo Fisher Scientific).
-
bioRxiv - Microbiology 2023Quote: The proteomic analysis of peptides was performed using Ultimate 3000 RSLCnano HPLC system (Thermo Scientific, USA), connected to the Q-exact HFX mass spectrometer (Thermo Scientific ...
-
bioRxiv - Plant Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Aurora Generation 2 ...
-
bioRxiv - Molecular Biology 2023Quote: ... Tryptic peptides were labeled using a tandem mass tag 10-plex isobaric label reagent set (ThermoFisher) following the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2023Quote: Tryptic peptides were separated using an Ultimate 3000 RSLCnano LC system (Thermo Fisher Scientific; Waltham, US) equipped with a PEPMAP100 C18 5 µm 0.3 x 5 mm trap (Thermo Fisher Scientific ...
-
bioRxiv - Biochemistry 2023Quote: ... the peptide concentration in samples was estimated using a Micro BCATM Protein Assay (Thermo Scientific, #23235), and a volume corresponding to 25 μg peptides was transferred to a new low-bind Eppendorf tube per sample ...
-
bioRxiv - Biochemistry 2023Quote: ... Crosslinked peptides were analyzed on an Orbitrap Fusion Lumos mass spectrometer (Thermo Scientific, San Jose, CA) coupled to a Dionex UltiMate 3000 RSCLnano System ...
-
bioRxiv - Biochemistry 2023Quote: Isobaric labelling of peptides was performed using TMTpro™ 16plex Label Reagent Set (Fisher Scientific, UK) according to the manufacturer’s recommended protocol (lot number ...
-
bioRxiv - Biochemistry 2022Quote: ... Peptides were ionized via electrospray ionization and analyzed by Orbitrap Eclipse and QExactive HFX (Thermo Fisher) mass spectrometer ...
-
bioRxiv - Cell Biology 2023Quote: ... Mass spectrometric analysis of eluting peptides was conducted on an Orbitrap Exploris 480 (Thermo Fisher Scientific) instrument platform with a spray voltage of 1.8 kV ...
-
bioRxiv - Cell Biology 2022Quote: ... Separated peptides were electrosprayed and analyzed using a Q-Exactive HF mass spectrometer (Thermo Fisher Scientific), operated in positive polarity in a data-dependent mode ...
-
bioRxiv - Cell Biology 2023Quote: ... and the resultant tryptic peptides were labeled with acetonitrile-dissolved TMT reagents (Thermo Scientific, Rockford, IL), and equal amounts of labeled samples were mixed before prefractionation with reversed phase (RP)-high performance liquid chromatography (HPLC) ...
-
bioRxiv - Cell Biology 2023Quote: Immunoprecipitated protein complex beads were digested into peptides using 500ng sequencing grade trypsin (Thermo Fisher Scientific) and incubated overnight at 37°C on a shaker ...
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Genetics 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
bioRxiv - Plant Biology 2023Quote: ... the peptides were sampled on a precolumn (300 μm x 5 mm PepMap C18, Thermo Scientific) and separated in a 75 μm x 250 mm C18 column (Reprosil-Pur 120 C18-AQ ...
-
Lactylation-driven FTO-mediated m6A modification of CDK2 aggravates diabetic microvascular anomaliesbioRxiv - Cell Biology 2023Quote: ... Peptides were then labeled with TMT using a TMT10plex mass tag labeling kit (Thermo Fisher Scientific) per the manufacturer’s instructions ...
-
bioRxiv - Cell Biology 2023Quote: ... Peptides were trapped onto a C18 PepMac100 precolumn (300 µm i.d.x5 mm, 100 Å, ThermoFisher Scientific) using Solvent A (0.1% Formic acid ...
-
bioRxiv - Cell Biology 2023Quote: ... Peptides were labeled using 100 ug of 16-plex tandem mass tag (TMTpro) reagents (Thermo Fisher), with incubation for 60 min at 22 °C ...