Labshake search
Citations for Thermo Fisher :
51 - 100 of 5526 citations for H Leu arg pro gly nh2 2hcl since 2020
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Microbiology 2023Quote: ... RNA was transferred to a Nytran Super Charge membrane (Whatman) using the NorthernMaxTM-Gly kit (Invitrogen) following the manufacturer’s instructions ...
-
bioRxiv - Synthetic Biology 2024Quote: ... was incubated at 30°C for 8 h in a customized PURE system in which Lys and Arg were replaced with stable isotope amino acids (0.36 mM 13C6 L-lysine-2HCl, 0.36 mM 13C6, 15N4 L-arginine-HCl) (Thermo Scientific) to express aaRS ...
-
bioRxiv - Neuroscience 2020Quote: ... rinsed in PBST with TO-PRO-3® (abbreviated TO-PRO; ThermoFisher Scientific), mounted with Aqua-Mount (Lerner ...
-
bioRxiv - Immunology 2020Quote: Ten micrograms of total RNA (RIN > 8 for all samples) was mixed with Gly Loading Dye (Ambion) and heated to 48°C for 1 hour ...
-
bioRxiv - Neuroscience 2023Quote: ... PO-PRO-1 iodide (435/355) (1 mM Solution in DMSO) (PO-PRO; ThermoFisher) was incubated in slices for a minimum of 3 hrs at a concentration of 5 μM (final DMSO concentration = 0.5%) ...
-
bioRxiv - Developmental Biology 2022Quote: ... or TO-PRO-3 (Invitrogen) for 10 min at RT or O/N at 4°C ...
-
bioRxiv - Developmental Biology 2022Quote: ... To-Pro-3 (Molecular Probes) or 4’,6-diamidino-2-phenylindole (DAPI ...
-
bioRxiv - Immunology 2021Quote: ... YO-PRO-1 (Invitrogen, USA) was used for nuclear staining ...
-
bioRxiv - Immunology 2024Quote: ... or TO-PRO-3TM (Invitrogen). The immunofluorescent photomicrographs were acquired with the Axiovert 200M inverted microscope (Carl Zeiss ...
-
bioRxiv - Immunology 2023Quote: ... or TO-PRO-3 (ThermoFisher). Samples were mounted using ProLong Diamond Antifade Mountant and curated for 24 hours before imaging ...
-
bioRxiv - Microbiology 2024Quote: ... in Opti-PRO medium (Gibco) supplemented with 25 mM HEPES (Gibco) ...
-
bioRxiv - Biochemistry 2020Quote: ... Urine metabolite separation and analysis was conducted using a Waters ACQUITY H-class LC system coupled with a LTQ-Orbitrap Velos Pro mass spectrometer (Thermo Fisher Scientific, MA). The following 18-min gradient on a Waters HSS C18 column (3.0 × 100 mm ...
-
bioRxiv - Cell Biology 2023Quote: ... (Lys4/Arg6)] or Heavy [L-Lysine 2HCl (13C6, 15N2) / L-Arginine HCl (13C6, 15N4) (Lys8/Arg10)] isotopes of lysine and arginine (Thermo Scientific).
-
bioRxiv - Cell Biology 2024Quote: ... and NEAT1-KO AC16 cells were labeled with heavy [l-lysine 2HCl (13C6, 15N2)/l-arginine HCl (13C6, 15N4) (Lys8/Arg10)] isotopes of lysine and arginine (Thermo Scientific). All labeled cells were seeded on a P60 dish ...
-
bioRxiv - Cell Biology 2024Quote: ... deficient in both L-lysine and L-arginine was supplemented with 1% dialyzed FBS and heavy amino acids 13C615N2 L-Lysine-2HCl and 13C615N4 L-Arginine-HCl (Thermo Scientific) at concentrations of 0.499 mM and 0.699 mM ...
-
bioRxiv - Cell Biology 2024Quote: ... deficient in both L-lysine and L-arginine was supplemented with B27 with insulin and heavy amino acids 13C615N2 L-Lysine-2HCl and 13C615N4 L-Arginine-HCl (Thermo Scientific) at concentrations 0.219 mM and 1.149 mM ...
-
bioRxiv - Biophysics 2021Quote: ... ZIKV strain UniProt ID: A0A024B7W1) (NH2-AARAAQKRTAAGIMKNPVVDGIVVTDIDMTIDPQVEKK-COOH) with 96% purity was purchased from Thermo scientific USA and dissolved in buffer consisting of 20 mM sodium phosphate buffer (pH 7.4) ...
-
bioRxiv - Molecular Biology 2024Quote: ... were analyzed using reversed-phase LC-ESI-MS/MS using a Waters Aquity UPLC H class system (Waters Corp., Milford, MA) coupled with a Velos Pro Orbitrap mass spectrometer (Thermo Scientific, San Jose, CA). Prior to analysis ...
-
bioRxiv - Neuroscience 2022Quote: ... TO-PRO® or DAPI (1:5000 in PBS for 10 min; TO-PRO®: Invitrogen, #T-3605 ...
-
bioRxiv - Immunology 2024Quote: ... including rabbit anti-pro-surfactant protein C (pro-SPC, Fisher Scientific, Waltham, MA, catalog no. AB3786), rabbit anti-cytokeratin 13 (CK13 ...
-
bioRxiv - Biochemistry 2022Quote: ... Fifteen to 20 μg of protein was loaded into a 4-20% Tris-Gly SDS-PAGE gel (Life Technologies) and transferred onto a nitrocellulose membrane with the iBlot 2 semidry transfer system (Life Technologies) ...
-
bioRxiv - Physiology 2021Quote: ... Approximately 30 μg of soluble supernatant was run on a 4-20% Tris-Gly SDS PAGE gel (Life Technologies) and transferred onto a nitrocellulose membrane using an iBlot2 device (Life Technologies) ...
-
bioRxiv - Neuroscience 2020Quote: ... TO-PRO-3 (Thermo Fisher Scientific), or Hoechst 33258 in the blocking buffer for 60 min.
-
bioRxiv - Neuroscience 2020Quote: ... and TO-PRO-3 (ThermoFisher, T3605) were added together with the secondary antibody.
-
bioRxiv - Developmental Biology 2020Quote: ... TO-PRO-3 iodide (Molecular Probes) was used to detect DNA at 1:500.
-
bioRxiv - Systems Biology 2021Quote: ... with FAIMS Pro interface (Thermo Scientific) and an EASY-nLC™ 1200 system (Thermo Scientific ...
-
bioRxiv - Neuroscience 2021Quote: ... Multisite Gateway Pro Recombination (Thermo Fisher) was used to assemble the 5’ and 3’ genomic regions surrounding LexA in the pBGRY destination vector 46 ...
-
bioRxiv - Evolutionary Biology 2023Quote: ... TO-PRO-3 dye (Molecular Probes) was used for nuclei staining after RNAse A (Invitrogen™ Ambion™ ...
-
bioRxiv - Neuroscience 2023Quote: ... TO-PRO-3 Iodide (TOPRO) (ThermoFisher) was used as a nuclear counter-stain.
-
bioRxiv - Cancer Biology 2024Quote: ... on QuantStudio 7 pro (Applied Biosystems). For gene expression quantifications the Ct values of the target genes were normalized to GAPDH (human ...
-
bioRxiv - Bioengineering 2020Quote: ... for the aqueous EDC chemistry and biotinylation of NH2-MRBLEs or dimethyl sulfoxide (DMSO, Thermo Fisher Scientific) for oligonucleotide conjugation ...
-
bioRxiv - Cell Biology 2024Quote: ... AVLPQEEEGSC-NH2) was completed as previously published49 and chemiluminescent images taken using an iBright1500 (Invitrogen, Thermo Fisher). Images were analyzed using ImageJ software50 and data expressed as incident power density (IPD ...
-
bioRxiv - Cell Biology 2024Quote: ... AVLPQEEEGSC-NH2) was completed as previously published49 and chemiluminescent images taken using an iBright1500 (Invitrogen, Thermo Fisher). Images were analyzed using ImageJ software50 and data expressed as incident power density (IPD ...
-
bioRxiv - Biochemistry 2021Quote: ... 1-4 μg of total RNA was loaded on 1% agarose-glyoxal gel prepared with NorthernMax-Gly gel prep running buffer (Ambion) and transferred to nylon membranes (BrightStar-Plus ...
-
bioRxiv - Microbiology 2023Quote: ... Airdried membranes were then UV cross-linked (254 nm; 120mJ/cm2) and hybridized to biotin-conjugated probes using the NorthernMax-Gly system following manufacturer protocols (Invitrogen). The following 5’-biotinylated probes were synthesized commercially (IDT) ...
-
bioRxiv - Immunology 2021Quote: ... PE-pro-IL-1β (NJTEN3, ThermoFisher Scientific), FITC-F4/80 (BM8 ...
-
bioRxiv - Immunology 2022Quote: ... or Stem Pro Accutase (Gibco, A11105-01) at 37°C for 5-7 min ...
-
bioRxiv - Developmental Biology 2022Quote: ... To-Pro-3 (1:500, Invitrogen T3605). Secondary antibodies were obtained from Jackson ImmunoResearch or Invitrogen and used at 1:200.
-
bioRxiv - Biochemistry 2020Quote: ... or Orbitrap Velos Pro instrument (Thermo Scientific) equipped with a C8 column (Aeres C8 ...
-
bioRxiv - Cell Biology 2021Quote: ... TO-PRO-3 Fluorescent Nuclear Stain (ThermoFisher) was used ...
-
bioRxiv - Systems Biology 2020Quote: ... a FAIMS Pro device (Thermo Fisher Scientific) was used in some experiments.24 For detailed information about the gradients and methods utilized ...
-
bioRxiv - Microbiology 2021Quote: ... QuantStudio 6/7 Pro systems (Applied Biosystems). The following primers were used ...
-
bioRxiv - Microbiology 2020Quote: ... stained using Pro-Q Emerald 300 (Invitrogen), and imaged using UV transillumination (Biorad Chemidoc MP) ...
-
bioRxiv - Cancer Biology 2022Quote: ... NCS was from Merck and Pro-Q Diamond was from ThermoFisher.
-
bioRxiv - Neuroscience 2021Quote: ... mounted using Pro-Long Gold Antifade (Invitrogen), and cover slipped (#1 cover slip ...
-
bioRxiv - Immunology 2020Quote: ... YO-PRO-1 (1 μM) (Invitrogen, Y3603). The pyroptotic process was monitored at 34°C and 7.5% CO2 using a fully automated spinning disk confocal microscope (PerkinElmer Technologies ...
-
bioRxiv - Cancer Biology 2020Quote: ... and mounted using pro-long gold (Invitrogen). FISH images were acquired on a DeltaVision elite system (Applied Precision ...
-
bioRxiv - Biochemistry 2020Quote: ... Pro-Q Diamond (Thermo Fisher Scientific™). Protocol was followed as recommended by the supplier ...
-
bioRxiv - Neuroscience 2021Quote: ... or QuantStudio 7 Pro SmartStart (Applied Biosystems) real-time PCR system ...
-
bioRxiv - Molecular Biology 2020Quote: ... and Multisite gateway Pro (Thermo Fisher Scientific).