Labshake search
Citations for Thermo Fisher :
851 - 900 of 10000+ citations for Rat LIM Domain Kinase 2 LIMK2 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
Identification of echinacoside as a tobramycin potentiator against Pseudomonas aeruginosa aggregatesbioRxiv - Microbiology 2024Quote: ... Diluted samples were subjected to c-di-GMP ELISA kit and Pierce™ 660nm protein assay reagent (Thermo Fisher) following manufacturer’s instructions ...
-
bioRxiv - Immunology 2024Quote: ... MCPT1 concentration of serum samples was determined using the MCPT-1 (mMCP-1) Mouse Uncoated ELISA Kit from Invitrogen (Waltham ...
-
bioRxiv - Neuroscience 2021Quote: ... and rat anti-mCherry (ThermoFisher) at 1:2,000 ...
-
bioRxiv - Cell Biology 2022Quote: ... and Sec16B (rat) (Ambion, s137156).
-
bioRxiv - Cell Biology 2022Quote: ... or rat (Thermo Fisher Scientific) anti-tdTom ...
-
bioRxiv - Cell Biology 2020Quote: ... mCherry (16D7, rat, ThermoFisher, M11217), mCherry (rabbit ...
-
bioRxiv - Bioengineering 2021Quote: ... rat monoclonal anti-Ki67 (Invitrogen), isolectin GS-IB4 (Invitrogen ...
-
bioRxiv - Neuroscience 2020Quote: ... rat-Alexa488 (Invitrogen, 488 excitation), goat-STARRED (Abberior ...
-
bioRxiv - Microbiology 2021Quote: ... and Donkey anti-rat (Invitrogen).
-
bioRxiv - Microbiology 2021Quote: ... goat anti-rat-Alexa594 (Invitrogen), all used at 1:2000 ...
-
bioRxiv - Cell Biology 2020Quote: ... or anti-rat (FITC, Invitrogen) and anti-rabbit (FITC ...
-
bioRxiv - Pathology 2022Quote: ... anti-Rat 488 (A21208, Invitrogen); anti-Rabbit 488 (A21206 ...
-
bioRxiv - Developmental Biology 2021Quote: ... anti-SOX2 (rat monoclonal; Invitrogen), and Uteroglobin (rat polyclonal ...
-
bioRxiv - Developmental Biology 2020Quote: ... rabbit and rat (Life Technologies) as secondary antibodies.
-
bioRxiv - Developmental Biology 2020Quote: ... rabbit or rat IgG (Invitrogen).
-
bioRxiv - Bioengineering 2019Quote: ... anti-rat AlexaFluor488 (Invitrogen; A21208), anti-rabbit AlexaFluor488 (Invitrogen ...
-
bioRxiv - Bioengineering 2019Quote: ... anti-rat AlexaFluor594 (Invitrogen; A21209), anti-rat AlexaFluor488 (Invitrogen ...
-
bioRxiv - Pathology 2020Quote: ... rat α-GFAP (Thermo Fisher Scientific ...
-
bioRxiv - Cancer Biology 2021Quote: ... anti-Rat 488 (Invitrogen, A21208) and anti-Mouse 488 (Invitrogen ...
-
bioRxiv - Immunology 2020Quote: ... 0.5% normal rat serum (Invitrogen), and 1 µg/ml 2.4G2 (BD ...
-
bioRxiv - Neuroscience 2021Quote: ... rat anti-Ki-67 (Invitrogen), rabbit anti-Ki67 (Cell Signaling Technologies) ...
-
bioRxiv - Immunology 2021Quote: ... 0.5% normal rat serum (Invitrogen), and 1 μg/ml 2.4G2 (BD ...
-
bioRxiv - Immunology 2020Quote: ... mouse/rat (Thermo Fisher Scientific). Quality and amount of RNA were determined using the Qubit RNA BR Assay Kit with Qubit 2.0 (Thermo Fisher Scientific ...
-
Intrarenal B cells integrate in situ innate and adaptive immunity in human renal allograft rejectionbioRxiv - Immunology 2020Quote: ... rat anti-FLAG (ThermoFisher Scientific) was used as the secondary antibody ...
-
bioRxiv - Neuroscience 2022Quote: ... rat monoclonal DAT (Invitrogen, MAB369), and anti-RFP (Takara ...
-
bioRxiv - Neuroscience 2022Quote: ... and mCherry (rat, Thermo Fisher Scientific Cat# M11217 ...
-
bioRxiv - Physiology 2023Quote: ... Rat Kupffer cells (ThermoFisher, RTKCCS) were cultured according to the manufacturer ...
-
bioRxiv - Neuroscience 2023Quote: ... Rat astrocytes (Gibco™, N7745100) were consecutively seeded at a density of 100 cells/mm2 ...
-
bioRxiv - Neuroscience 2022Quote: ... -anti-rat 568 (Invitrogen, #A11004) were used 1:1000 dilution as secondary antibody ...
-
bioRxiv - Neuroscience 2023Quote: ... Rat mCherry 1:1000 (Invitrogen)) ...
-
bioRxiv - Neuroscience 2023Quote: ... rat mCherry (1:1000) (Invitrogen), mouse puromycin (1:1000 ...
-
bioRxiv - Bioengineering 2023Quote: ... rat tail (A1048301, Thermo Fisher); Dulbecco’s Modified Eagle Medium (DMEM ...
-
bioRxiv - Cell Biology 2022Quote: ... anti-rat AF488 (ThermoFisher A21208)) ...
-
bioRxiv - Microbiology 2022Quote: ... anti-rat-HRP (Invitrogen, #31470), anti-sheep-HRP (A16041 ...
-
bioRxiv - Neuroscience 2023Quote: ... Anti-Rat AF 568 (Invitrogen), Anti-Rabbit AF 647 (Invitrogen)) ...
-
bioRxiv - Developmental Biology 2023Quote: ... anti-rat AF488 (Invitrogen, A21208); anti-goat AF488 (Invitrogen ...
-
bioRxiv - Molecular Biology 2023Quote: ... anti-rat Alexa Fluor546 (Invitrogen) and anti-guinea pig Cy3 (Jackson ImmunoResearch Inc.).
-
bioRxiv - Developmental Biology 2023Quote: ... EpCAM (rat, 1:100, Invitrogen), Sca-1 (rat ...
-
bioRxiv - Immunology 2024Quote: ... Goat anti-Rat Alexa555 (Invitrogen); and Goat anti-Rat Alexa647 (Invitrogen) ...
-
bioRxiv - Neuroscience 2024Quote: ... Rat-GFAP (1:1000, Thermofisher), Rabbit-GFAP (1:1000 ...
-
bioRxiv - Biochemistry 2021Quote: ... The chemically synthesized p53 TAD2 domain peptide (38QAMDDLMLSPDDIEQWFTEDPGPD61) was obtained with >90% purity from Thermo Scientific, USA ...
-
bioRxiv - Molecular Biology 2021Quote: ... the gene encoding PDGFR transmembrane domain was amplified by PCR using pDisplay vector (Thermo Fisher Scientific) as a template ...
-
bioRxiv - Plant Biology 2020Quote: ... A Y2H prey library of Arabidopsis NTL proteins fused to the GAL4 activation domain (pDEST22; Invitrogen) was similarly created and transformed into the opposite yeast mating strain ...
-
bioRxiv - Developmental Biology 2020Quote: Robo1 domain deletions were generated via site-directed mutagenesis using Phusion Flash PCR MasterMix (Thermo Scientific), and completely sequenced to ensure no other mutations were introduced ...
-
bioRxiv - Bioengineering 2022Quote: ... The gene encoding PDGFR transmembrane domain was amplified by PCR using pDisplay vector (Thermo Fisher Scientific) as a template ...
-
bioRxiv - Immunology 2022Quote: Sequences for VH and VL domains were codon optimized using GeneArt (Thermo Fisher Scientific, Waltham, MA) and gene blocks for each domain were purchased from Integrated DNA Technologies (IDT ...
-
bioRxiv - Microbiology 2023Quote: ... followed by an incubation with mouse anti-human E-cad cytoplasmic domain mAb (4A2C7, Life Technologies). In some experiments ...
-
bioRxiv - Biophysics 2022Quote: NS2B cytosolic domain peptide with >97 % purity (residues 49-95; VDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEDDGPPMA) was purchased from Thermo Fisher Scientific ...
-
bioRxiv - Bioengineering 2023Quote: ... The novel PTGFRN transmembrane domain display systems were codon optimized and DNA synthesized by Thermo Fisher. All plasmids were sequence-verified ...
-
bioRxiv - Neuroscience 2023Quote: ... or lacking the CTLH (ΔCTLH) and LISH (ΔLISH) domain were cloned by the Gateway® (Invitrogen) method into pDONR221 entry vector and then recombined into a yeast low-copy number CEN destination vector (Addgene ...