Labshake search
Citations for Thermo Fisher :
751 - 800 of 1635 citations for Benzo Ghi Perylene D12 98% 97% Chemical Purity since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Biochemistry 2021Quote: ... All other chemicals were obtained from Fisher Scientific Canada.
-
bioRxiv - Genomics 2021Quote: ... All other chemicals were purchased from Fisher Scientific.
-
bioRxiv - Biochemistry 2022Quote: ... All other chemicals were purchased from Thermo Fisher Scientific.
-
bioRxiv - Bioengineering 2023Quote: ... all other chemicals were purchased from Thermo Fisher Scientific ...
-
bioRxiv - Molecular Biology 2023Quote: ... After chemical digestion in 2.5X trypsin (Gibco #15400054) - 2mg/ml DNaseI (Roche ...
-
bioRxiv - Bioengineering 2022Quote: All chemical reagents were purchased from Acros Organics or Sigma Aldrich and were used without further purification ...
-
bioRxiv - Bioengineering 2023Quote: ... all other chemicals were obtained from Thermo Fisher Scientific (Waltham ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... All other chemicals were supplied by Fisher Scientific.
-
bioRxiv - Neuroscience 2023Quote: ... 0.32 μM sodium hydroxybutyrate (A1161314, ThermoFisher Scientific Chemicals), 78 nM Q-VD-Oph (SML0063 ...
-
bioRxiv - Neuroscience 2023Quote: ... lacosamide (465325000) (Thermo Scientific Chemicals, Waltham, MA, USA), was solubilized in saline ...
-
Sphingosine induction of the Pseudomonas aeruginosa hemolytic phospholipase C/sphingomyelinase, PlcHbioRxiv - Microbiology 2023Quote: All media and standard chemicals purchased from ThermoFisher or Sigma ...
-
bioRxiv - Biophysics 2024Quote: ... and 0.2% Glutaraldehyde (Thermo Scientific Chemicals, A17876.AE) in HBSS on ice for 1 hour.
-
bioRxiv - Biochemistry 2023Quote: All chemical reagents were procured from Thermo Fisher Scientific (Waltham ...
-
bioRxiv - Biochemistry 2023Quote: The following chemicals were obtained from Thermo Fisher Scientific ...
-
bioRxiv - Microbiology 2023Quote: ... and 400 μL of isopropanol (Thermo Scientific Chemicals). Samples were incubated overnight at -20 °C ...
-
bioRxiv - Immunology 2024Quote: All chemicals were purchased from ThermoFisher (Waltham, MA) unless otherwise stated ...
-
bioRxiv - Neuroscience 2023Quote: ... mifepristone (459980010) (Thermo Scientific Chemicals, Waltham, MA, USA), was solubilized in 100% DMSO ...
-
bioRxiv - Biochemistry 2023Quote: ... Solvents were of ACS chemical grade (Fisher Scientific) and were used without further purification ...
-
bioRxiv - Cell Biology 2023Quote: ... Spermine-NONOate at 0.5 mM (Thermo Scientific Chemicals) and grown for 24 h at 37 °C ...
-
bioRxiv - Neuroscience 2024Quote: Chemicals and peptides were purchased from Fisher Scientific, Sigma-Aldrich or R&D systems until mentioned otherwise ...
-
bioRxiv - Cell Biology 2020Quote: ... RNA quantity and purity from all samples were assessed using a NanoDrop Spectrophotometer (Thermo Fisher Scientific).
-
bioRxiv - Molecular Biology 2021Quote: ... and the concentration and purity determined by spectrophotometry (Nanodrop 1000, Thermo Fisher Scientific Inc., Waltham, MA). The HDR target site(s ...
-
bioRxiv - Microbiology 2021Quote: ... The concentration and purity of RNA was determined using a NanoDrop spectrophotometer (Thermo Scientific, Waltham, MA). RNA was treated with Turbo DNase (Invitrogen ...
-
bioRxiv - Developmental Biology 2020Quote: ... RNA quantification and purity were determined on NanoDrop 2000 UV-vis spectrophotometer (Thermo Scientific®, USA). Samples were DNase I treated (Sigma Aldrich ...
-
bioRxiv - Molecular Biology 2021Quote: ... and their purity was verified on 1% agarose gel with SYBR Safe reagent (Thermo Fisher Scientific) and visualized on G-Box Chemi XR5 system (Syngene).
-
bioRxiv - Molecular Biology 2020Quote: ... Genomic DNA purity and concentration were measured with an ND-1000 NanoDrop spectrophotometer (Thermo Fisher Scientific). attB (236 bp) ...
-
bioRxiv - Molecular Biology 2021Quote: ... The DNA concentration and purity were measured using a NanoDrop (Thermo Fisher Scientific, Waltham, MA, USA).
-
bioRxiv - Genomics 2020Quote: ... The concentration and purity of the eluted DNA were measured using a NanoDrop spectrophotometer (Thermo Scientific), and approximately 400 ng of DNA was used for sequencing library preparation.
-
bioRxiv - Genomics 2020Quote: ... and measured the purity and concentration of the resulting DNA with NanoDrop ND-1000 spectrophotometer (Thermofisher). A diagnostic PCR to test for the presence of the Wolbachia wsp gene was performed by using the primers wsp81F (5’-tggtccaaaatgtgagaaac-3’ ...
-
bioRxiv - Bioengineering 2019Quote: ... Protein purity was assessed by SDS-PAGE using SYPRO™ Ruby Protein Gel Stain (ThermoFisher, S12000).
-
bioRxiv - Pharmacology and Toxicology 2019Quote: ... The purity of RNA samples was quantified using a NanoDrop ™Lite spectrophotometer (Thermo Scientific, UK) and only samples that had a minimum yield of 100 ng/μL and A260/280 >1.9 were used in the experiments ...
-
bioRxiv - Genomics 2019Quote: ... The RNA concentration and purity was determined using a Nanodrop 2000c (Thermo Scientific, Wilmington, DE, USA). Quality and integrity of the isolated RNA were checked on an Agilent Bioanalyzer 2100 total RNA Nano series II chip (Agilent ...
-
bioRxiv - Genomics 2020Quote: ... Genomic DNA concentration and purity were assessed with a Qubit 2.0 Fluorometer (ThermoFisher Scientific, MA, USA) and NanoDrop 2000 spectrophotometer (ThermoFisher Scientific ...
-
bioRxiv - Biochemistry 2021Quote: ... The chemically synthesized p53 TAD2 domain peptide (38QAMDDLMLSPDDIEQWFTEDPGPD61) was obtained with >90% purity from Thermo Scientific, USA ...
-
bioRxiv - Biophysics 2021Quote: ... ZIKV strain UniProt ID: A0A024B7W1) (NH2-AARAAQKRTAAGIMKNPVVDGIVVTDIDMTIDPQVEKK-COOH) with 96% purity was purchased from Thermo scientific USA and dissolved in buffer consisting of 20 mM sodium phosphate buffer (pH 7.4) ...
-
bioRxiv - Neuroscience 2021Quote: ... The concentration and purity of purified DNA was assessed using a NanoDrop ND-2000/2000c (ThermoFisher). DNA was only used if it had an A260/A280 ratio between 1.8–2.0 ...
-
bioRxiv - Neuroscience 2020Quote: ... All RNA isolates were assessed for concentration and purity using a Nanodrop 2000c Spectrophotometer (Thermofisher Scientific) and/or an Agilent 2100 Bioanalyzer.
-
bioRxiv - Bioengineering 2021Quote: ... The purity and concentration of DNA were measured with Nanodrop spectrophotometer (Model 2000C, Thermo Scientific, USA). The extracted DNA was stored immediately at −70 °C prior to the sequencing ...
-
bioRxiv - Plant Biology 2020Quote: ... RNA quantity and purity were analyzed in a Nanodrop 2000 Spectrophotometer (Thermo fisher Scientific, Waltham, MA).
-
bioRxiv - Plant Biology 2020Quote: ... DNA concentration and purity were measured with a NanoDrop ND-1000 spectrophotometer (Thermo Scientific, Waltham, MA). Eleven SSR markers (Table 1 ...
-
bioRxiv - Microbiology 2020Quote: ... RNA purity was validated through UV-Vis spectrophotometry via Nanodrop Lite (Thermo Scientific, Wilmington, DE, USA). 1μg of total RNA was reverse-transcribed to complementary DNA (cDNA ...
-
bioRxiv - Plant Biology 2021Quote: ... and the RNA purity was determined through NanoDrop 2000 UV-Vis Spectrophotometer (Thermo Scientific, Loughborough, UK). First-strand cDNA was synthesized by using SOLIScript RT cDNA synthesis MIC (Solis Biodyne ...
-
bioRxiv - Microbiology 2020Quote: ... The RNA and cDNA products’ purity and quantity were assessed by a NanoDrop spectrophotometer (Thermo Scientific). The cDNA products were normalized to ~ 40 ng/μl with DNAse free sterile water prior to qPCR reactions.
-
bioRxiv - Neuroscience 2020Quote: ... The concentration and purity of RNA was determined by a Nanodrop spectrophotometer (Thermo Fisher Scientific, Slovakia). The reverse transcription was carried out using a High-Capacity cDNA Reverse Transcription Kit (Thermo Fisher Scientific ...
-
bioRxiv - Cell Biology 2020Quote: ... Concentration and purity were determined by absorbance using NanoDrop (NanoDrop, 2000C, Thermo Fisher Scientific, Waltham, MA). Concentration of total RNA was adjusted to 60 ng/μl and cDNA was synthesized using iScript Reverse Transcriptase Supermix (BioRad ...
-
bioRxiv - Cell Biology 2022Quote: ... and the RNA concentrations and purity were determined using a NanoDrop One (ThermoFisher Scientific, Watham, MA) spectrophotometer ...
-
bioRxiv - Molecular Biology 2022Quote: ... purity was checked by 8% urea-PAGE gel electrophoresis and SYBR gold RNA dye (Thermo Fisher) was used to visualize RNA (Figure S2d).
-
bioRxiv - Immunology 2022Quote: ... and RNA purity and concentration (ng/μl) was confirmed using a NanoDrop Spectrophotometer (Thermo Fisher Scientific) where a 260/280 readout greater than or equal to 1.8 was considered pure.
-
bioRxiv - Microbiology 2022Quote: ... The total RNA concentration and purity were detected using a NanoDrop 2000 (Thermo Fisher Scientific, USA). Total RNA (500 ng ...
-
bioRxiv - Animal Behavior and Cognition 2022Quote: ... The purity and quantity of RNA were checked using NanoDrop 1000 spectrophotometer (Thermo Fisher Scientific, USA) for downstream experiments.