Labshake search
Citations for Thermo Fisher :
6951 - 7000 of 10000+ citations for C Reactive Protein Blocking Peptide since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Genomics 2022Quote: ... tryptic peptides (1 mg) were decomplexed by reversed phase nanoLC separation (Ultimate 3000 nanoRSLC; Thermo Fisher Scientific, Dreieich, Germany) using a trap column setup (2 cm length ...
-
bioRxiv - Microbiology 2022Quote: ... LC-MS/MS analysis of digested peptides was performed on an Orbitrap Eclipse mass spectrometer (Thermo Fisher Scientific, Bremen) coupled to an EASY-nLC 1000 (Thermo Fisher Scientific) ...
-
bioRxiv - Plant Biology 2022Quote: ... the resulting peptides were quantified via absorbance measurements at 205 nm using a NanoDrop 2000c spectrophotometer (Thermo Fisher Scientific) and then injected into a NanoAcquity ultra-performance LC coupled to a Q-TOF SYNAPT G2-Si mass spectrometer (Waters ...
-
bioRxiv - Microbiology 2023Quote: ... Peptides were trapped on a C18 column (75 μm inner diameter × 2 cm; NanoViper Acclaim PepMapTM 100, Thermo Scientific) with buffer A (2/98 MeCN/H2O in 0.1% formic acid ...
-
bioRxiv - Microbiology 2023Quote: ... Peptides were trapped on a C18 column (75 μm inner diameter × 2 cm; NanoViper Acclaim PepMapTM 100, Thermo Scientific) with buffer A (2/98 MeCN/H2O in 0.1% formic acid ...
-
bioRxiv - Genomics 2022Quote: Peptide samples were solubilized in 0.1% formic acid and fractionated using a nano-LC Easy 1000 system (Thermo Fisher) coupled to an Orbitrap-type mass spectrometer (Q Exactive Plus ...
-
bioRxiv - Neuroscience 2022Quote: ... The peptide samples were analysed on an LTQ-OrbitrapXL mass spectrometer Kit (Thermo Fisher Scientific, Rock ford, IL, USA) coupled to the Eksigent nanoLC-Ultra® 2D system (AB Sciex ...
-
Multiomic Approach Characterises the Neuroprotective Role of Retromer in Regulating Lysosomal HealthbioRxiv - Neuroscience 2022Quote: ... peptides in 1% (vol/vol) formic acid were injected onto an Acclaim PepMap C18 nano-trap column (Thermo Scientific). After washing with 0.5% (vol/vol ...
-
bioRxiv - Neuroscience 2022Quote: ... The peptides obtained were extracted with 50 mM AmBic buffer and dried with a SpeedVac (Thermo Fisher Scientific, USA) and stored at −80 °C prior to quantitative and qualitative analyses by shotgun mass spectrometry (MS) ...
-
bioRxiv - Plant Biology 2022Quote: ... Peptides were analyzed by MS as follows: a 1 μL injection was made onto a C8 trap column (ThermoFisher, μ-precolumn – 300 μm i.d ...
-
bioRxiv - Plant Biology 2022Quote: ... Analysis of the eluted tryptic peptides was performed online using a Q Exactive™ Plus mass spectrometer (Thermo Scientific) possessing a Nanospray Flex™ Ion source (Thermo Fisher ...
-
bioRxiv - Plant Biology 2022Quote: Peptides were eluted at 300 nL/min from a 75 μm x 50 cm PepMap C18 column (Thermo Scientific) using the following gradient ...
-
bioRxiv - Cancer Biology 2022Quote: Peptide mass spectra were acquired using either Orbitrap Fusion Lumos or Orbitrap Eclipse Tribrid mass spectrometer (Thermo Fisher Scientific) with MS1 Orbitrap resolution of 240000 and MS/MS fragmentation of the precursor ions by collision-induced dissociation (CID ...
-
bioRxiv - Microbiology 2022Quote: The concentration of peptide stock solution was determined by absorption measurement at 205 nm using a Nanodrop instrument (ThermoFisher), and confirmed using a Pierce(tm ...
-
bioRxiv - Immunology 2022Quote: ... 750,000 PBMCs were incubated either with DMSO (negative control) or with 9-mer and 15-mer peptides in 0.5 ml RPMI (Gibco) +10% Human AB serum (Sigma ...
-
bioRxiv - Evolutionary Biology 2022Quote: ... Eluting peptides were on-line ionized by nano-electrospray (nESI) using the Nanospray Flex Ion Source (Thermo Fisher Scientific) at 1.5 kV (liquid junction ...
-
bioRxiv - Cancer Biology 2022Quote: ... Peptides were loaded onto a C18 trap column (Acclaim PepMap, 100 A 5 µm particle size, Thermo Fisher Scientific) at a flow rate of 5 µL/min in Solvent A (0.1% formic acid in water ...
-
bioRxiv - Cell Biology 2022Quote: ... This combined sample was then subjected to fractionation using the high pH reversed-phase peptide fractionation kit (Thermo Fisher) for a final of six fractions for the nuclear eluates ...
-
bioRxiv - Neuroscience 2024Quote: ... Measurements of peptide library fractions were performed on a quadrupole-ion-trap-orbitrap MS (Orbitrap Fusion, Thermo Fisher Scientific) in orbitrap-orbitrap configuration ...
-
bioRxiv - Systems Biology 2024Quote: DISPA of the plasma proteome peptides was performed on an Orbitrap Fusion Lumos™ mass spectrometer (Thermo Fisher Scientific) coupled with the FAIMS Pro Interface ...
-
bioRxiv - Bioengineering 2024Quote: ... Peptides were then analysed on a Ultimate 3500 RSLCnano system (Dionex) and a Q-Exactive HF (Thermo Fisher Scientific) mass spectrometer ...
-
bioRxiv - Plant Biology 2024Quote: ... Eluting peptides were on-line ionized by nano-electrospray (nESI) using the Nanospray Flex Ion Source (Thermo Fisher Scientific) at 1.5 kV (liquid junction ...
-
bioRxiv - Microbiology 2024Quote: ... Peptides were separated using a 140 min gradient generated by an EASY-nLC 1000 liquid chromatography (Thermo Fisher Scientific) with the column heated to 50 °C by a PRSO-V1 column oven (Sonation) ...
-
bioRxiv - Cell Biology 2023Quote: The fractionated peptides were analysed by LC-MS/MS using a fully automated Ultimate 3000 RSLC nano System (ThermoFisher) fitted with a 100 μm x 2 cm PepMap100 C18 nano trap column and a 75 μm×25 cm ...
-
bioRxiv - Physiology 2024Quote: ... Approximately 7 µg of tryptic peptide from each tissue sample was labeled with TMT-Pro 16 plex (Thermo Scientific) reagents according to the manufacturer’s instructions ...
-
bioRxiv - Microbiology 2024Quote: ... Peptide separation was performed using a reversed-phase analytical column (Acclaim PepMap RSLC, 0.075 × 250 mm (Thermo Fisher Scientific)) with a linear gradient of 4-27.5% solvent B (0.1% FA in 98% ACN ...
-
bioRxiv - Genomics 2024Quote: ... Desalted peptides were labeled with the TMT-10plex mass tag labeling reagent according to the manufacturer’s instructions (Thermo Scientific) with small modifications ...
-
bioRxiv - Neuroscience 2024Quote: ... Quantification of histone peptides were performed in nanoLC coupled online to an LTQ-Orbitrap Elite mass spectrometer (Thermo Scientific). About 1-5 μg of desalted samples were then separated using a 75 μm ID x 17 cm Reprosil-Pur C18-AQ (3 μm ...
-
bioRxiv - Biophysics 2023Quote: The PUR4 (also known as FUD) peptide (sequence: KDQSPLAGESGETEYITEVYGNQQNPVDIDKKLPNETGFSGNMVETEDT) and the scrambled control (sequence: EKGYSKPPVGNEGGDQVDEYDTMSQTKLEDEGNTLISPITFENATEQVN) were synthesised by ThermoFisher Scientific without any tags or modifications ...
-
bioRxiv - Cell Biology 2023Quote: ... The eluted peptides were sprayed into a LTQ Orbitrap Velos mass spectrometer (Thermo Fisher Scientific, San Jose, CA, USA) equipped with a nano-ESI ion source ...
-
bioRxiv - Microbiology 2023Quote: ... the peptides were resuspended in 0.1% (v/v) formic acid and desalted using C18 Zip tips (Pierce, Thermo Scientific). The peptides were again dried by vacuum centrifugation before being reconstituted in 50 µL of 0.1% (v/v ...
-
bioRxiv - Biochemistry 2024Quote: Peptide samples were dissolved in 0.1% FA and analyzed on the Orbitrap Eclipse Tribrid Mass spectrometer (Thermo Fisher Scientific) coupled to an Easy-nLC 1200 HPLC system (Thermo Fisher Scientific) ...
-
bioRxiv - Microbiology 2024Quote: ... Peptides were trapped on a C18 Acclaim PepMap 100 (5 µm, 300 µm x 5mm) trap column (ThermoFisher Scientific) and eluted onto a C18 Acclaim PepMap100 3 µm ...
-
bioRxiv - Immunology 2024Quote: TMT-labelled tryptic peptides were subjected to HpRP fractionation using an Ultimate 3000 RSLC UHPLC system (Thermo Fisher Scientific) equipped with a 2.1 mm internal diameter (ID ...
-
bioRxiv - Microbiology 2024Quote: ... We quantified the abundance of the peptides using the Pierce Micro BCA assay (Thermo Scientific Pierce, Rockford, IL, USA) following the manufacturer’s instructions.
-
bioRxiv - Bioengineering 2023Quote: The peptide digests were subjected to LC MS/MS analysis using an UltiMate 3000 RSLC system (Thermo Fisher Scientific) coupled in-line to an Orbitrap Fusion Lumos mass spectrometer (Thermo Fisher Scientific) ...
-
Ribonuclease Inhibitor and Angiogenin collaboratively regulate cell-type-specific global translationbioRxiv - Biochemistry 2024Quote: ... Peptides were trapped on a micro-precolumn C18 PepMap100 (5μm, 100 Å, 300 μm×5mm, ThermoFisher Scientific, Reinach, Switzerland) and separated by backflush onto the analytical nano-column (C18 ...
-
bioRxiv - Biochemistry 2024Quote: ... Samples were injected onto a 300μm x 5mm PepMap Neo Trap Cartridge peptide trap column (C18, 5μm particle size, 100Å pore size, ThermoFisher Scientific) and separated on an EASY-Spray 75μm x 50cm PepMap HPLC column (C18 ...
-
bioRxiv - Biochemistry 2024Quote: ... Samples were injected onto a 300μm x 5mm PepMap Neo Trap Cartridge peptide trap column (C18, 5μm particle size, 100Å pore size, ThermoFisher Scientific) and separated on an EASY-Spray 75μm x 50cm PepMap HPLC column (C18 ...
-
bioRxiv - Biochemistry 2024Quote: ... 75 µm x 50 cm) and peptides then analysed using an Orbitrap Eclipse Tribrid mass spectrometer (Thermo Fisher Scientific). Solvent A comprised 0.1% formic acid (v/v ...
-
bioRxiv - Cancer Biology 2024Quote: ... Each peptide extract was loaded on a 300 μm ID x 5 mm PepMap C18 precolumn (Thermo Scientific, USA) at a flow rate of 10 μL/min ...
-
bioRxiv - Biochemistry 2023Quote: ... Eluted peptides were analysed by using an Orbitrap Fusion Lumos Tribrid Mass Spectrometer (Thermo Fisher Scientific, Waltham, MA, USA).
-
bioRxiv - Biochemistry 2023Quote: ... 1.5 µg of peptide was analysed on the Exploris 480 coupled with a Dionex Ultimate 3000 RS (Thermo Scientific). LC buffers prepared as follows ...
-
bioRxiv - Microbiology 2023Quote: ... peptide quantitative features were extracted from LC-MS files using SIEVE (v2.2, Thermo Fisher Scientific, San Jose, CA, USA) and processed by the UHR-IonStar APP to generate final quantification results ...
-
bioRxiv - Molecular Biology 2022Quote: The peptide samples were analysed on a nano liquid chromatography system (Ultimate 3000 nano HPLC system, Thermo Fisher Scientific) coupled to an Orbitrap Exploris 240 mass spectrometer (Thermo Fisher Scientific) ...
-
bioRxiv - Molecular Biology 2023Quote: ... Peptide separation was performed using a reversed-phase analytical column (Acclaim PepMap RSLC, 0.075 x 250 mm, Thermo Scientific) with a linear gradient of 4%-27.5% solvent B (0.1% FA in 98% ACN ...
-
bioRxiv - Molecular Biology 2023Quote: ... The desalted peptides were labeled with the TMT11plex mass tag labeling reagent according to the manufacturer’s instructions (ThermoFisher Scientific) with small modifications ...
-
bioRxiv - Biochemistry 2022Quote: The peptide samples were analyzed on a nano liquid chromatography system (Ultimate 3000 nano HPLC system, Thermo Fisher Scientific) coupled to an Orbitrap Exploris 240 mass spectrometer (Thermo Fisher Scientific) ...
-
bioRxiv - Cancer Biology 2023Quote: Peptides from 833 µm resolution samples were analysed by LC-MS/MS using a Dionex Ultimate 3000 (Thermo Scientific) coupled to a timsTOF Pro (Bruker ...
-
bioRxiv - Microbiology 2023Quote: ... Peptide samples were loaded onto a 75 µm x 2 cm Acclaim PepMap 100 C18 trap column (Thermo Scientific) in 0.1% formic acid ...