Labshake search
Citations for Peprotech :
101 - 150 of 1340 citations for SCF Human HEK293 His since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2022Quote: ... hCD34+ cells were either kept in culture at 37°C in RPMI medium with human recombinant Stem Cell Factor (SCF) at 50 ng/ml (PeproTech, Rocky Hill, NJ, USA), human recombinant thrombopoietin (TPO ...
-
bioRxiv - Cell Biology 2019Quote: ... mouse IL-6 and mouse SCF (10 ng/mL each) (Peprotech) in a 6-well culture plate ...
-
bioRxiv - Neuroscience 2022Quote: ... and 20 ng/mL stem cell factor (SCF) (all from Peprotech). 50% of the media was replaced every other day ...
-
bioRxiv - Synthetic Biology 2022Quote: ... and mouse recombinant cytokines (100 ng/ml SCF (Peprotech, 250-03), 50 ng/ml Flt3-L (Peprotech ...
-
bioRxiv - Genomics 2022Quote: ... and recombinant murine SCF 50 ng/mL (PeproTech # 250-03-250UG), murine IL-3 10 ng/mL (PeproTech #313-13-10UG ...
-
bioRxiv - Molecular Biology 2023Quote: ... IL-6 10 ng/mL and SCF 50 ng/mL (Peprotech) for the first two weeks and then IL-3 10ng/mL for ongoing culturing ...
-
bioRxiv - Cell Biology 2023Quote: ... supplemented with SCF (100 ng/ml; Peprotech; cat. no., 300-07), TPO (100 ng/ml ...
-
bioRxiv - Immunology 2021Quote: ... TGFβ1 (HEK293 derived) and TGFβ2 (HEK293 derived) were acquired from Peprotech (Rocky Hill, NJ). Primary antibody [mouse monoclonal IgG anti-Vimentin (V9)] ...
-
bioRxiv - Immunology 2021Quote: ... and were supplemented with 100 ng/ml mouse SCF (250-03 PeproTech) and 100 ng/ml mouse FLT3-Ligand (250-31L PeproTech ...
-
bioRxiv - Developmental Biology 2020Quote: ... both 100 ng/mL rhVEGF-165 and 50 ng/mL SCF (PeproTech) were supplemented ...
-
bioRxiv - Cancer Biology 2022Quote: ... 100 ng/mL SCF (R&D) and 100 ng/mL TPO (Peprotech). Cultures were pre-stimulated for 24 h ...
-
bioRxiv - Bioengineering 2021Quote: ... supplemented with 100 ng/mL SCF (#250-03, Peprotech, Rocky Hill, NJ) and 1% PenStrep and cultured at 5% CO2 and 37 °C ...
-
bioRxiv - Neuroscience 2020Quote: ... 10 ng/mL IL-3 and stem cell factor (SCF; all Peprotech). From now on ...
-
bioRxiv - Developmental Biology 2020Quote: ... treated with 5 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 1 ...
-
bioRxiv - Developmental Biology 2021Quote: ... and treated with 25 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 24 hours.
-
bioRxiv - Biochemistry 2021Quote: Recombinant human platelet-derived growth factor-BB (PDGF-BB) and recombinant human transforming Growth Factor-β1 (TGFβ1; HEK293 derived) were purchased from PeproTech (Hamburg, Germany) and they were dissolved in sterile ddH2O ...
-
bioRxiv - Cell Biology 2020Quote: ... supplemented with 100 ng/ml Stem Cell Factor (SCF, PeproTech, Rocky Hill, NJ), 100 ng/ml Fms-related tyrosine kinase 3 ligand (Flt3L ...
-
Low basal expression and slow induction of IFITM3 puts immune cells at risk of influenza A infectionbioRxiv - Immunology 2019Quote: ... 20 ng/mL SCF (Bio-Techne) and 50 ng/mL VEGF (Peprotech EC Ltd.) in ultra-low attachment plates (Corning ...
-
bioRxiv - Developmental Biology 2021Quote: ... The first 3 days in GMEM containing 100 ng/ml SCF (Peprotech, 250-03), 10 µM forskolin (Sigma-Aldrich ...
-
bioRxiv - Bioengineering 2021Quote: ... SI = 100 ng/mL murine SCF + 10 ng/mL murine IL-3 (both Peprotech)) was added per well and cells were cultured at 37°C and 5% CO2 ...
-
bioRxiv - Molecular Biology 2022Quote: CD34+GFP+ HSPCs from UCB were cultured in granulocytic differentiation medium (SCF 25ng/mL, PeproTech, Cat 300-07 ...
-
bioRxiv - Immunology 2019Quote: ... then cells were stimulated with 100ng/ml DNP-BSA and/or 50ng/ml SCF (Peprotech) for 4 hours at 37C ...
-
bioRxiv - Immunology 2019Quote: ... Recombinant murine cytokines (IL-3, IL-5, IL-9, GM-CSF, SCF) were from Peprotech.
-
bioRxiv - Cell Biology 2023Quote: ... this was supplemented with SCF (25 ng/ml) and G-CSF (25 ng/ml, PeproTech). PBS or OSM was added at 500ng/ml to both medias ...
-
bioRxiv - Molecular Biology 2022Quote: Transduced and FACs sorted CD34+ HSPCs were cultured in erythroid differentiation medium (SCF 25ng/mL, PeproTech, Cat 300-07 ...
-
bioRxiv - Immunology 2019Quote: ... with a mixture of cytokines (100 ng/ml Fit3L, IL-7, SCF, TPO; all from PeproTech) before transferred to Retronectin pre-coated plate (50ug/ml ...
-
bioRxiv - Cancer Biology 2021Quote: ... and supplemented with murine SCF (10 ng/ml) and IL-3 (10 ng/ml) (Peprotech or BioLegend). The cells were serially passaged for ∼1 month ...
-
bioRxiv - Developmental Biology 2021Quote: ... FACS-isolated Flk1+ mesodermal cells were cultured at 5 x104 cells/cm2 in SP34 plus SCF (Peprotech) and VEGF (R&D) ...
-
bioRxiv - Cell Biology 2021Quote: ... an additional 5ml of medium along with a hematopoietic cytokine cocktail consisting of 50ng/ml SCF (Peprotech), 50ng/ml of VEGF (Peprotech) ...
-
bioRxiv - Cancer Biology 2022Quote: ... Cells were initially cultured in IMDM +20 % FBS (AtlantaBiologics) in recombinant murine IL-3 and SCF (Peprotech), both at 50 ng/mL ...
-
bioRxiv - Molecular Biology 2022Quote: ... supplemented with cytokines (150 ng/ml SCF, PeproTech, Cat 300-07; 150 ng/ml Flt-3, PeproTech, Cat 300-19 ...
-
bioRxiv - Neuroscience 2023Quote: ... Mice were subcutaneously injected daily with recombinant mouse SCF (200 μg/kg/day, diluted with saline, PeproTech) and recombinant human G-CSF (50 μg/kg/day ...
-
bioRxiv - Cancer Biology 2023Quote: ... TF-1 cells were maintained in RPMI supplemented with 10% FBS and 2ng/ml hGC-SCF (PeproTech). K562 cells were cultured in IMDM supplemented with 10% FBS ...
-
bioRxiv - Immunology 2023Quote: ... 10 ng/ml recombinant stem cell factor (SCF) and 10 ng/ml IL-3 (both from Peprotech). Femur and tibia bone marrows from one mouse were initially seeded in 10 ml medium in a 25 cm2 tissue culture flask (Corning ...
-
bioRxiv - Immunology 2022Quote: ... The CD34 cell purity was checked by FACS and cells were cultured in IMDM with 10% HI FBS supplemented with human cytokine and growth factor cocktail from Peprotech (hTPO (#300-18) (10 ng/ml) ...
-
bioRxiv - Immunology 2021Quote: ... Lin-cells were culture in complete RPMI medium (cRPMI) containing 20 ng/ml of SCF (PeproTech, #250-03), TPO (PeproTech ...
-
bioRxiv - Cell Biology 2020Quote: ... and subsequently transduced with the respective barcoded vector via spin-infection in StemSpan medium containing 50µg/µL Stem Cell Factor (SCF, PeproTech). Transduction efficiency was measured via flow cytometry and quantified via expression of the respective fluorescent protein three days post transduction ...
-
bioRxiv - Molecular Biology 2020Quote: ... supplemented with 1% HSA (Baxter) and cytokines (SCF 100ng/mL, FLT3L 100ng/mL and TPO 100ng/mL; all from PeproTech)55 ...
-
bioRxiv - Systems Biology 2019Quote: ... and 106 cells were transferred onto each retronectin/DL1-coated virus-bound well supplemented with 5 ng/mL SCF (Peprotech), 5 ng/mL Flt3-L ...
-
bioRxiv - Developmental Biology 2020Quote: ... and cytokines (100 ng/mL SCF, 100 ng/mL IL-3 and 100 ng/mL Flt3 ligand, all from PeproTech). After 7 days of co-culture ...
-
Combining LSD1 and JAK-STAT inhibition targets Down syndrome-associated myeloid leukemia at its corebioRxiv - Cancer Biology 2022Quote: ... and a cytokine cocktail (FLT3-L, SCF, IL-6, IL-3, TPO; all purchased from PeproTech, Rocky Hill, NJ, USA). Samples were taken from pediatric AML patients treated as part of the AML Berlin-Frankfurt-Münster study group ...
-
The transcription factor RUNX2 drives the generation of human NK cells and promotes tissue residencybioRxiv - Immunology 2022Quote: After 48 hours of culture in preculture medium (complete IMDM medium supplemented with 10% FCS, stem cell factor (SCF) (100 ng/mL, Peprotech), FMS-like tyrosine kinase-3 ligand (FLT3-L ...
-
bioRxiv - Molecular Biology 2022Quote: Transduced and FACs sorted CD34+ HSPCs were cultured in erythroid differentiation medium (SCF 25ng/mL, PeproTech, Cat 300-07; EPO 3U/mL, PeproTech, Cat 100-64 ...
-
bioRxiv - Molecular Biology 2022Quote: ... supplemented with cytokines (150 ng/ml SCF, PeproTech, Cat 300-07; 150 ng/ml Flt-3, PeproTech, Cat 300-19; 10 ng/ml IL-6, PeproTech, Cat 200-06 ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Cancer Biology 2023Quote: ... and conditioned media containing approximately 100 ng/ml SCF for the generation of neutrophil-biased cells or GM-CSF 10 ng/ml (Peprotech) for the generation of macrophage progenitors ...
-
bioRxiv - Immunology 2023Quote: ... mouse bone marrow was flushed and cultured for 2 days in stem cell medium (DMEM + 15% FCS + 25ng/ml SCF (PeproTech) + 10ng/ml IL-3 (PeproTech ...
-
bioRxiv - Cell Biology 2023Quote: ... Bone marrow-derived dendritic cells were generated by culturing bone marrow progenitors in RPMI medium supplemented with 10% FBS and 20ng/ml granulocyte-macrophage colony-stimulating factor (GM-SCF, PeproTech) for 10 days.
-
bioRxiv - Immunology 2023Quote: ... Cells were cultured with stem cell factor (SCF) and FMS-like tyrosine kinase 3 ligand (FLT3L) (Peprotech, Rocky Hill, USA) for the first 4 days ...
-
bioRxiv - Immunology 2024Quote: ... Cells were expanded for at least 1 week in the presence of IL-3 and 30 ng/mL recombinant SCF (Peprotech) to obtain peritoneal cavity-derived mast cells (PCMCs) ...