Labshake search
Citations for Peprotech :
551 - 600 of 1786 citations for Respiratory syncytial virus RSV fusion protein exodomain human heterodimeric IgG1 Fc tag recombinant antigen since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2021Quote: ... injection and mice were dosed with 1×104 units recombinant human IL-2 (Peprotech) twice daily for 3 days (6 total injections) ...
-
bioRxiv - Immunology 2020Quote: ... and human recombinant Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF, Peprotech, New Jork, USA) at 50 ng/ml ...
-
bioRxiv - Physiology 2022Quote: ... Recombinant Human TNF-α (300-01A) and IL-1β (200-01B) were from PeproTech.
-
bioRxiv - Neuroscience 2020Quote: ... 20 ng/mL recombinant human epidermal growth factor (EGF) (PeproTech, Cat. # AF-100-15) and 10 ng/mL recombinant human fibroblast growth factor-2 (FGF-2 ...
-
bioRxiv - Immunology 2022Quote: ... 1 x glutamax and 50 IU/ml human recombinant IL-2 (Peprotech, Cranbury, NJ). Enriched CD4+ and CD8+ T cells were activated with ImmunoCult NHP CD2/CD3/CD28 T-cell activator (STEMCELL Technologies ...
-
bioRxiv - Molecular Biology 2022Quote: ... 50 ng/mL recombinant human epidermal growth factor (EGF, PeproTech, Cat# AF-100-15), 10 % (v/v ...
-
bioRxiv - Systems Biology 2019Quote: ... cells were treated with 100 ng/ml of recombinant human TRAIL Apo/2L (PeproTech). The fluorescence signal and the time of death of transfected cells were calculated using ImageJ (NIH ...
-
HIV-1 Nef interacts with LMP7 to attenuate immunoproteasome formation and MHC-I antigen presentationbioRxiv - Microbiology 2019Quote: Recombinant human IFN-γ (rhIFN-γ) was purchased from Peprotech (Rocky Hill, NJ, USA). ER-Tracker Red dyes were purchased from Invitrogen ...
-
bioRxiv - Cancer Biology 2020Quote: ... or SFM supplemented with 20 ng/ml human recombinant epidermal growth factor (hEGF; PeproTech) and 20 ng/ml recombinant human fibroblast growth factor (hFGF ...
-
bioRxiv - Cell Biology 2021Quote: ... human recombinant EGF was replaced with 100 ng/ml bFGF/FGF2 (Peprotech, #450-33)19 ...
-
bioRxiv - Cancer Biology 2022Quote: ... ATL55T+ was incubated with recombinant human interleukin 2 (rIL-2, 100 U/ml; PeproTech) because of its dependency ...
-
bioRxiv - Neuroscience 2022Quote: ... and 20ng/mL recombinant human fibroblast growth factor-basic (FGF-b; PeproTech US, NJ). hNPCs were maintained under 37°C and 5% CO2 conditions ...
-
bioRxiv - Neuroscience 2023Quote: ... 20 ng/mL recombinant human brain derived neurotrophic factor (BDNF, #450-02, Peprotech, Germany), 10 ng/mL recombinant human glial cell line-derived neurotrophic factor (GDNF ...
-
bioRxiv - Cell Biology 2023Quote: ... supplemented with 50ng/mL recombinant human vascular endothelial growth factor-A (VEGF-A) (Peprotech), 50ng/mL recombinant fibroblast growth factor 2 (Peprotech) ...
-
bioRxiv - Genomics 2023Quote: ... and 15 ng/mL of recombinant human interleukin 2 (IL-2) (Peprotech, 200-02). Cells were kept in a humidified 5% CO2 atmosphere at 37°C.
-
bioRxiv - Biophysics 2023Quote: ... EGF-stimulated cells were treated with 50 nM recombinant human EGF (PeproTech, #AF-100) for 3 min at 37°C to ensure activation of EGFR on the basal surface of the cell ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... Recombinant human granulocyte-monocyte colony stimulating factor (rhGM-CSF) was from Peprotech (London, UK). Pullulan gel filtration standards (Mw = 180−788,000 g/mol ...
-
bioRxiv - Neuroscience 2023Quote: ... and recombinant Human/Murine/Rat Activin A (50 ng ml−1; PeproTech, 120-14P). From day 12 ...
-
bioRxiv - Immunology 2023Quote: Cytokine stimulation was performed using either human recombinant IFNγ (Peprotech 300-02, 50ng/ml) and human recombinant TNFα (Peprotech 300-01A ...
-
bioRxiv - Immunology 2024Quote: ... The complex was freshly prepared by incubating recombinant human IL-15 (Peprotech, 200-15) with IL-15Rα-Fc (R&D Systems ...
-
bioRxiv - Neuroscience 2024Quote: ... supplemented with 4 ng/ml human recombinant FGF (Fibroblast Growth Factor, Peprotech, 100-18B) and 50 µM Rock inhibitor Y27632 (Millipore ...
-
bioRxiv - Immunology 2023Quote: ... 1 ml of media supplemented with 20 ng/ml recombinant human GM-CSF (Peprotech) was added to each well ...
-
bioRxiv - Bioengineering 2024Quote: ... supplemented with 10 ng/mL recombinant human hepatocyte growth factor (HGF; Peprotech; 100-39), 20 ng/mL recombinant human oncostatin M (OSM ...
-
bioRxiv - Cell Biology 2024Quote: 0.15 ug/ml of recombinant mouse protein CXCL9 (Peprotech, Cat #: 250-18) and 0.1 ug/ml of recombinant mouse protein CXCL10 (Peprotech ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Developmental Biology 2020Quote: ... and 5 ng/mL for each of brain-derived neurotrophic factor (BDNF, recombinant human, PeproTech, 450-02 ...
-
bioRxiv - Cell Biology 2022Quote: ... 100 μg/mL streptomycin and 20 ng/mL recombinant human EGF (AF-100-15, PeproTech).
-
bioRxiv - Genetics 2020Quote: ... and fresh pre-warmed media containing low dose recombinant human IL-7 (1ng/ml; Peprotech) was added to promote T cell survival without stimulation85 ...
-
bioRxiv - Cell Biology 2019Quote: ... 2 ng ml−1 recombinant human TGFβ1 (112 amino acid, HEK293-derived, Peprotech, 100-21). Cells were routinely maintained in E8 medium on 1:800 diluted growth factor reduced Matrigel (see below) ...
-
bioRxiv - Immunology 2019Quote: ... both in the presence or absence of 10 ng/mL recombinant human interferon gamma (Peprotech), all conditions in triplicate wells ...
-
bioRxiv - Immunology 2019Quote: ... cells were stimulated with recombinant human IL-2 (100 U/ml) (Peprotech, Rocky Hill, NJ) for 45 min at 37°C ...
-
bioRxiv - Neuroscience 2020Quote: ... and 20 ng/ml recombinant human Fibroblast Growth Factor-basic (FGF-2, 100-18B, Peprotech) onto poly-Lysine D coated cell culture plates (Corning) ...
-
bioRxiv - Bioengineering 2021Quote: ... 5 ng/mL human recombinant Platelet-Derived Growth Factor-AA (PDGF-AA, Peprotech, 100-13A) and 5 ng/mL FGF2 were added ...
-
bioRxiv - Bioengineering 2021Quote: ... 5 ng/mL human recombinant Platelet-Derived Growth Factor-AA (PDGF-AA, Peprotech, 100-13A) and 5 ng/mL FGF2 were added ...
-
bioRxiv - Bioengineering 2021Quote: ... 100 ng/mL animal-free recombinant human Stem Cell Factor (SCF, Peprotech, AF-300-07), and 10 µM RA ...
-
bioRxiv - Bioengineering 2021Quote: ... 100 ng/mL animal-free recombinant human Stem Cell Factor (SCF, Peprotech, AF-300-07), and 10 μM all-trans retinoic acid (RA ...
-
bioRxiv - Cell Biology 2021Quote: ... murine IL-3 (213-13) and Recombinant Human EPO (100-64) were obtained from PeproTech.
-
bioRxiv - Molecular Biology 2022Quote: ... Recombinant human tumor necrosis factor-alpha was purchased from PeproTech (Rocky Hill, NJ; #300-01A).
-
bioRxiv - Molecular Biology 2020Quote: ... 1 mL of base medium supplied with 12 μg/mL Recombinant Human FGF-basic (PEPROTECH) and KnockOutTM Serum Replacement (1:100 ...
-
bioRxiv - Microbiology 2020Quote: Dividing THP-1 cells were treated with 10 ng/mL recombinant human IL-1β (Peprotech) for the times indicated ...
-
bioRxiv - Bioengineering 2022Quote: A solution of 5 µg/mL FGF2 (recombinant human FGF-basic, Peprotech, New Jersey, USA) containing 0.1 % BSA (albumin fraction V (Carl Roth GmbH + Co ...
-
bioRxiv - Molecular Biology 2019Quote: ... but supplemented with 100 ng ml−1 human recombinant noggin (Peprotech, cat. no. 120-10C) and 20% R-spondin conditioned medium (Sigma ...
-
bioRxiv - Genomics 2021Quote: ... in a 3:1 beads:cells ratio and 100 U/mL recombinant human IIL-2 (Peprotech). Non-tissue culture treated 12-well plates were prepared by incubating 1 mL PBS + 25 μg/mL Retronectin (Takara ...
-
bioRxiv - Genomics 2021Quote: ... in a 3:1 beads:cells ratio and 100 U/mL recombinant human IL-2 (Peprotech).
-
bioRxiv - Immunology 2021Quote: ... we used complete media containing 20 ng/ml human recombinant interleukin-2 (rIL-2, PeproTech). Naïve CD4+ T cells (106/ml ...
-
bioRxiv - Immunology 2020Quote: ... M2c cells with 25 ng/mL recombinant human IL-10 (PeproTech; Rock Hill, NJ, USA); and M2d MΦs from stimulation with and 50 ng/mL recombinant human IL-6 (R&D Systems ...
-
bioRxiv - Immunology 2022Quote: ... cells were cultured in complete RPMI containing recombinant human IL-2 (30 U/ml, Peprotech) and stimulated with anti-CD3/anti-CD28 Dynabeads (Invitrogen ...