Labshake search
Citations for Peprotech :
51 - 100 of 1448 citations for Recombinant Mouse Pdcd1 Protein Fc Avi tagged Biotinylated since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2023Quote: ... 100 ng/mL mouse recombinant Noggin (Peprotech #250-38) and 300 ng/mL human R-spondin1 (R&D Systems #4645-RS).
-
bioRxiv - Immunology 2023Quote: ... supplemented with 1ng/mL recombinant mouse IL-4 (Peprotech)) ...
-
bioRxiv - Immunology 2023Quote: ... In some conditions recombinant mouse IL2 and IL12 (Peprotech) were added at 20ng/ml and 2.5ng/ml respectively or at concentrations as indicated ...
-
bioRxiv - Immunology 2024Quote: ... and 20 ng/ml recombinant mouse GM-CSF (Peprotech). The cells were incubated at 37°C for seven days to induce macrophage differentiation ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... Mouse recombinant cytokine IL-4 were from Peprotech (USA). The detection kit of nitric oxide (NO ...
-
bioRxiv - Molecular Biology 2020Quote: ... The recombinant murine IFN-γ protein was purchased from PeproTech Inc ...
-
MET functions in tumour progression and therapy resistance are repressed by intronic polyadenylationbioRxiv - Molecular Biology 2023Quote: ... cells were stimulated with 50ng/mL recombinant HGF protein (Peprotech) or mock preparation for 15 min.
-
bioRxiv - Cancer Biology 2020Quote: ... 50uL recombinant mouse IL-6 (10ug/ml) (Peprotech #200-06) and cultured at 37°C ...
-
bioRxiv - Immunology 2019Quote: ... All cytokines were recombinant mouse cytokines (Peprotech, Rocky Hill, NJ) except the erythropoietin (Eprex ...
-
bioRxiv - Genetics 2022Quote: ... and 10 ng/ml recombinant mouse stem cell factor (Peprotech).
-
bioRxiv - Immunology 2023Quote: ... 20 ng/ml recombinant mouse M-CSF (R&D/PeproTech) for 7 days ...
-
bioRxiv - Cancer Biology 2023Quote: ... 20 ng/mL mouse recombinant EGF (Peprotech, cat.n 315-09), 20 ng/mL human recombinant FGF (Peprotech ...
-
bioRxiv - Biochemistry 2023Quote: ... human recombinant IL-1β and TNF-α proteins from PeproTech (UK). A clinicaltrials.gov search on February 13 ...
-
bioRxiv - Biochemistry 2023Quote: ... Recombinant Human IL-6 protein was purchased from Peprotech (Cranbury, USA) Albumin from human serum (HSA ...
-
bioRxiv - Cancer Biology 2019Quote: ... 100 ng/mL mouse recombinant noggin (Peprotech, Rocky Hill, NJ, USA), 50 ng/mL human recombinant EGF (Peprotech ...
-
bioRxiv - Immunology 2022Quote: ... with or without recombinant mouse IL-12 (20 ng/ml; Peprotech) and recombinant mouse IL-18 (10ng/ml ...
-
bioRxiv - Immunology 2021Quote: ... additionally supplemented with recombinant mouse GM-CSF (10 ng/ml; Peprotech) at 37°C ...
-
bioRxiv - Cell Biology 2020Quote: ... and supplemented with recombinant mouse GM-CSF (10 ng/ml) (Peprotech). Loosely adherent cells were harvested after 6 or 10 days of maturation ...
-
bioRxiv - Immunology 2021Quote: ... and supplemented with recombinant mouse GM-CSF (20 ng/ml, Peprotech). Loosely adherent cells (DCs ...
-
bioRxiv - Genetics 2022Quote: ... supplemented with 50ng/mL recombinant mouse stem cell factor (rmSCF, Peprotech), 10ng/mL recombinant mouse interleukin 3 (rmIL-3 ...
-
bioRxiv - Bioengineering 2022Quote: ... Mouse neutrophils treated with recombinant human TGFβ1 (10 ng/mL; PeproTech) for 24 h served as a positive control for NR polarization 56.
-
bioRxiv - Cell Biology 2022Quote: ... and 30 ng/ml recombinant mouse GM-CSF (Peprotech #315-03) and seeded into a 15 cm dish ...
-
bioRxiv - Synthetic Biology 2022Quote: ... and mouse recombinant cytokines (100 ng/ml SCF (Peprotech, 250-03), 50 ng/ml Flt3-L (Peprotech ...
-
bioRxiv - Immunology 2023Quote: ... and mouse recombinant 10ng/ml IFN-γ (PEPROTech Cat.315-05). For mTORC1 activation cells were treated with 5nM Bafilomycin A1 (Invivogen Cat ...
-
bioRxiv - Microbiology 2023Quote: ... media containing recombinant mouse IL-4 (PeproTech, Cat. No. 214-14) was added to cells 16 hours before infection ...
-
bioRxiv - Cell Biology 2023Quote: ... in combination with 200 ng/mL recombinant mouse IL-18 (Peprotech) or 50 ng/mL of recombinant human IL-15 (Miltenyi ...
-
bioRxiv - Molecular Biology 2023Quote: ... 10 ng/ml mouse recombinant IL-4 (Peprotech, 214-14-20), and agonist anti-CD40 antibody (0.5 μg/ml ...
-
bioRxiv - Bioengineering 2021Quote: ... mouse femoral head explants were stimulated using 10□ng□ml-1 recombinant mouse IL-1β (PeproTech) for 2 days ...
-
bioRxiv - Immunology 2023Quote: ... Surface IL-15 was stained with biotinylated anti-mouse IL-15 (polyclonal rabbit; PeproTech) followed by streptavidin-APC (R&D) ...
-
bioRxiv - Cancer Biology 2019Quote: ... Samples were examined by ELISA capturing with Fc-iNKG2D and detecting with biotinylated rabbit-anti-human IL-2 polyclonal antibody (Peprotech #500-P22BT) followed by incubation with streptavidin-HRP ...
-
bioRxiv - Immunology 2021Quote: ... co-cultures were treated with 100 ng/ml mouse recombinant IFNg (Peprotech). Activation of T-cells was assessed by flow cytometry on day 5.
-
Targeted attenuation of elevated histone marks at SNCA alleviates α-synuclein in Parkinson’s diseasebioRxiv - Neuroscience 2020Quote: ... and 100 ng/ml recombinant human/mouse FGF-8b (Peprotech, 100-25) from days 1-6 and 3-μM CHIR99021(Reprocell ...
-
bioRxiv - Immunology 2020Quote: ... and 20 ng/mL mouse recombinant GM-CSF (Peprotech, Rocky Hill, NJ). 10 mL media (50% of initial volume in Petri dish ...
-
bioRxiv - Immunology 2023Quote: ... and 10 ng/mL recombinant mouse IL-3 (Peprotech, Cat. # 213-13). TPA-MAT cells 40 were maintained in RPMI-1640 supplemented with 10% FBS ...
-
bioRxiv - Microbiology 2020Quote: ... the PBMCs were cultured with the synthetic peptide mixture of SARS-CoV-2 at a concentration of 1μg/ml or DMSO in RPMI 1640 medium containing 10% FCS and 20 U/ml recombinant human IL-2 (Peprotech) for 7 days ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2024Quote: ... together with 10 ng/mL recombinant mouse IL-4 or 3 μg/mL LPS with 10 ng/mL recombinant murine IFN-ψ (Peprotech) and 20 ng/mL recombinant human BAFF or 5 μg/mL anti-CD40 (Bio X Cell ...
-
bioRxiv - Molecular Biology 2019Quote: ... WNT3A recombinant protein (Cat#315-20) was purchased from PeproTech (Rocky Hill, NJ). WNT8A (Cat#8419-WN-010/CF ...
-
bioRxiv - Cell Biology 2023Quote: ... Recombinant HCC-1 protein (20ng/ml, PP-300-38B-2, Peprotech, United States) was added to cell culture medium ...
-
bioRxiv - Bioengineering 2023Quote: ... recombinant human Wnt-7a protein (PeproTech, cat# 120-31, 10-300 ng/mL), lithium chloride (LiCl ...
-
bioRxiv - Cell Biology 2021Quote: ... 20 ng/mL recombinant mouse macrophage colony-stimulating factor (PeproTech, Rocky Hill, NJ), and 5% penicillin/streptomycin ...
-
bioRxiv - Immunology 2022Quote: ... and supplemented with recombinant mouse M-CSF (Peprotech Inc. Cat No 315-02) at 20ng/mL for 5 days (Francke et al. ...
-
bioRxiv - Immunology 2023Quote: ... the organoid was stimulated with 150 ng/ml mouse recombinant TNF-α (PeproTech) for 24 h.45 All cells were cultured and maintained at 37 °C with 5% CO2.
-
bioRxiv - Immunology 2022Quote: ... or (15 ng/mouse) of recombinant-mouse IFN-γ (rIFN-γ expressed in E. coli; PeproTech, Rocky Hill, NJ), i.p ...
-
bioRxiv - Cancer Biology 2019Quote: ... using 5 μg/mL of the monoclonal anti-mouse IFN-γ antibody (eBioscience) for capture and 1 μg/mL of the polyclonal biotinylated anti-mouse IFN-γ antibody (PeproTech) for detection.
-
bioRxiv - Bioengineering 2021Quote: ... 100 ng/mL human recombinant Bone Morphogenic Protein 4 (BMP4, Peprotech, AF-120-05ET), 100 ng/mL animal-free recombinant human Stem Cell Factor (SCF ...
-
bioRxiv - Immunology 2022Quote: ... Recombinant murine macrophage chemoattractant protein 1 (MCP-1) (20 ng/mL; Peprotech, NJ, USA) was used as a positive control ...