Labshake search
Citations for Peprotech :
551 - 600 of 1759 citations for Recombinant Human CDH2 His Fc tagged since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2022Quote: ... ATL55T+ was incubated with recombinant human interleukin 2 (rIL-2, 100 U/ml; PeproTech) because of its dependency ...
-
bioRxiv - Neuroscience 2022Quote: ... and 20ng/mL recombinant human fibroblast growth factor-basic (FGF-b; PeproTech US, NJ). hNPCs were maintained under 37°C and 5% CO2 conditions ...
-
bioRxiv - Neuroscience 2023Quote: ... 20 ng/mL recombinant human brain derived neurotrophic factor (BDNF, #450-02, Peprotech, Germany), 10 ng/mL recombinant human glial cell line-derived neurotrophic factor (GDNF ...
-
bioRxiv - Cell Biology 2023Quote: ... supplemented with 50ng/mL recombinant human vascular endothelial growth factor-A (VEGF-A) (Peprotech), 50ng/mL recombinant fibroblast growth factor 2 (Peprotech) ...
-
bioRxiv - Developmental Biology 2023Quote: ... 5 nM recombinant human bone morphogenetic protein 4 (BMP4; Peprotech, # AF-120-05ET, USA) and 2 µM Smoothened agonist (SAG ...
-
bioRxiv - Genomics 2023Quote: ... and 15 ng/mL of recombinant human interleukin 2 (IL-2) (Peprotech, 200-02). Cells were kept in a humidified 5% CO2 atmosphere at 37°C.
-
bioRxiv - Biophysics 2023Quote: ... EGF-stimulated cells were treated with 50 nM recombinant human EGF (PeproTech, #AF-100) for 3 min at 37°C to ensure activation of EGFR on the basal surface of the cell ...
-
bioRxiv - Pharmacology and Toxicology 2023Quote: ... Recombinant human granulocyte-monocyte colony stimulating factor (rhGM-CSF) was from Peprotech (London, UK). Pullulan gel filtration standards (Mw = 180−788,000 g/mol ...
-
bioRxiv - Neuroscience 2023Quote: ... and recombinant Human/Murine/Rat Activin A (50 ng ml−1; PeproTech, 120-14P). From day 12 ...
-
bioRxiv - Immunology 2023Quote: Cytokine stimulation was performed using either human recombinant IFNγ (Peprotech 300-02, 50ng/ml) and human recombinant TNFα (Peprotech 300-01A ...
-
bioRxiv - Immunology 2024Quote: ... The complex was freshly prepared by incubating recombinant human IL-15 (Peprotech, 200-15) with IL-15Rα-Fc (R&D Systems ...
-
bioRxiv - Neuroscience 2024Quote: ... supplemented with 4 ng/ml human recombinant FGF (Fibroblast Growth Factor, Peprotech, 100-18B) and 50 µM Rock inhibitor Y27632 (Millipore ...
-
bioRxiv - Immunology 2023Quote: ... 1 ml of media supplemented with 20 ng/ml recombinant human GM-CSF (Peprotech) was added to each well ...
-
bioRxiv - Bioengineering 2024Quote: ... supplemented with 10 ng/mL recombinant human hepatocyte growth factor (HGF; Peprotech; 100-39), 20 ng/mL recombinant human oncostatin M (OSM ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Developmental Biology 2020Quote: ... and 5 ng/mL for each of brain-derived neurotrophic factor (BDNF, recombinant human, PeproTech, 450-02 ...
-
bioRxiv - Cell Biology 2022Quote: ... 100 μg/mL streptomycin and 20 ng/mL recombinant human EGF (AF-100-15, PeproTech).
-
bioRxiv - Genetics 2020Quote: ... and fresh pre-warmed media containing low dose recombinant human IL-7 (1ng/ml; Peprotech) was added to promote T cell survival without stimulation85 ...
-
bioRxiv - Cell Biology 2019Quote: ... 2 ng ml−1 recombinant human TGFβ1 (112 amino acid, HEK293-derived, Peprotech, 100-21). Cells were routinely maintained in E8 medium on 1:800 diluted growth factor reduced Matrigel (see below) ...
-
bioRxiv - Immunology 2019Quote: ... both in the presence or absence of 10 ng/mL recombinant human interferon gamma (Peprotech), all conditions in triplicate wells ...
-
bioRxiv - Immunology 2019Quote: ... cells were stimulated with recombinant human IL-2 (100 U/ml) (Peprotech, Rocky Hill, NJ) for 45 min at 37°C ...
-
bioRxiv - Neuroscience 2020Quote: ... and 20 ng/ml recombinant human Fibroblast Growth Factor-basic (FGF-2, 100-18B, Peprotech) onto poly-Lysine D coated cell culture plates (Corning) ...
-
bioRxiv - Bioengineering 2021Quote: ... 5 ng/mL human recombinant Platelet-Derived Growth Factor-AA (PDGF-AA, Peprotech, 100-13A) and 5 ng/mL FGF2 were added ...
-
bioRxiv - Bioengineering 2021Quote: ... 5 ng/mL human recombinant Platelet-Derived Growth Factor-AA (PDGF-AA, Peprotech, 100-13A) and 5 ng/mL FGF2 were added ...
-
bioRxiv - Bioengineering 2021Quote: ... 100 ng/mL animal-free recombinant human Stem Cell Factor (SCF, Peprotech, AF-300-07), and 10 µM RA ...
-
bioRxiv - Bioengineering 2021Quote: ... 100 ng/mL animal-free recombinant human Stem Cell Factor (SCF, Peprotech, AF-300-07), and 10 μM all-trans retinoic acid (RA ...
-
bioRxiv - Cell Biology 2021Quote: ... murine IL-3 (213-13) and Recombinant Human EPO (100-64) were obtained from PeproTech.
-
bioRxiv - Molecular Biology 2022Quote: ... Recombinant human tumor necrosis factor-alpha was purchased from PeproTech (Rocky Hill, NJ; #300-01A).
-
bioRxiv - Molecular Biology 2020Quote: ... 1 mL of base medium supplied with 12 μg/mL Recombinant Human FGF-basic (PEPROTECH) and KnockOutTM Serum Replacement (1:100 ...
-
bioRxiv - Microbiology 2020Quote: Dividing THP-1 cells were treated with 10 ng/mL recombinant human IL-1β (Peprotech) for the times indicated ...
-
bioRxiv - Bioengineering 2022Quote: A solution of 5 µg/mL FGF2 (recombinant human FGF-basic, Peprotech, New Jersey, USA) containing 0.1 % BSA (albumin fraction V (Carl Roth GmbH + Co ...
-
bioRxiv - Molecular Biology 2019Quote: ... but supplemented with 100 ng ml−1 human recombinant noggin (Peprotech, cat. no. 120-10C) and 20% R-spondin conditioned medium (Sigma ...
-
bioRxiv - Genomics 2021Quote: ... in a 3:1 beads:cells ratio and 100 U/mL recombinant human IIL-2 (Peprotech). Non-tissue culture treated 12-well plates were prepared by incubating 1 mL PBS + 25 μg/mL Retronectin (Takara ...
-
bioRxiv - Genomics 2021Quote: ... in a 3:1 beads:cells ratio and 100 U/mL recombinant human IL-2 (Peprotech).
-
bioRxiv - Immunology 2021Quote: ... we used complete media containing 20 ng/ml human recombinant interleukin-2 (rIL-2, PeproTech). Naïve CD4+ T cells (106/ml ...
-
bioRxiv - Immunology 2020Quote: ... M2c cells with 25 ng/mL recombinant human IL-10 (PeproTech; Rock Hill, NJ, USA); and M2d MΦs from stimulation with and 50 ng/mL recombinant human IL-6 (R&D Systems ...
-
bioRxiv - Immunology 2022Quote: ... cells were cultured in complete RPMI containing recombinant human IL-2 (30 U/ml, Peprotech) and stimulated with anti-CD3/anti-CD28 Dynabeads (Invitrogen ...
-
bioRxiv - Immunology 2022Quote: ... Monocytes were cultured in cRPMI supplemented with recombinant human IL-4 and GM-CSF (Peprotech) to generate immature monocyte-derived dendritic cells (Mo-DCs) ...
-
bioRxiv - Immunology 2022Quote: ... in the absence or presence of human recombinant (hr) IL-1β (10 ng/mL, Peprotech) and hrIL-23 (20 ng/mL ...
-
bioRxiv - Immunology 2022Quote: ... We further supplemented the media with 5 ng/mL recombinant human (rh) IL-2 (Peprotech) and 10 ng/mL rhIL-7 ...
-
bioRxiv - Molecular Biology 2022Quote: ... 200 ng/mL recombinant human fibroblast growth factor 10 (FGF10, PeproTech, Cat# 100-26-500), 1 nM gastrin (Tocris ...
-
bioRxiv - Immunology 2023Quote: ... USA)] in the presence of 10 ng/mL human recombinant M-CSF (PeproTech, Rocky Hill, NJ). Cells were incubated at a density of 3.0×106 cells/well for 7 days at 37 °C and 5% CO2 in ultra-low attachment six-well plates (Corning Life Sciences ...
-
bioRxiv - Bioengineering 2022Quote: ... were coated with 2 μg ml-1 of recombinant human PD-L1ECDFc (Peprotech 310-35), ZNRF3ECDFc (R&D systems 7994-RF-025 ...
-
bioRxiv - Molecular Biology 2023Quote: ... the cell culture medium was supplemented with 5 ng/ml recombinant human TGF-β (Peprotech), 10 µg/ml anti-IL-4 antibodies (clone 11B11) ...
-
bioRxiv - Cell Biology 2023Quote: ... and 2 ng/mL Recombinant Human Transforming Growth Factor-β1 (TGF-β1, PeproTech, 100-21). Cells were passaged when reaching 70% confluency until day 18 ...
-
A spatially resolved EGFR signaling model predicts the length scale of GAB1-SHP2 complex persistencebioRxiv - Systems Biology 2023Quote: ... Serum-starved cells were treated with recombinant human EGF (AF-100-15; PeproTech, Cranbury, NJ) at 10 ng/mL for ≤ 15 min ...
-
bioRxiv - Biochemistry 2023Quote: Cells were treated with 1000 U/mL of recombinant human IFN-β (PeproTech #300-02BC) or recombinant human IFN-α2 (PBL Assay Science #11105-1 ...