Labshake search
Citations for Peprotech :
51 - 100 of 810 citations for PD 1 Mouse HEK293 Fc since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2023Quote: ... mouse bone marrow was flushed and cultured for 2 days in stem cell medium (DMEM + 15% FCS + 25ng/ml SCF (PeproTech) + 10ng/ml IL-3 (PeproTech ...
-
bioRxiv - Immunology 2019Quote: IL-2 complex (IL-2C) was prepared as described(79) by incubating 1 μg recombinant mouse IL-2 (PeproTech) with 5 μg purified anti-mouse IL-2 antibody (JES6-1 ...
-
bioRxiv - Immunology 2023Quote: ... The following anti-mouse primary antibodies were used: anti-RELM-beta (1:500, rabbit polyclonal antibody, Peprotech, 500-p215), anti-MUC2 (1:200 ...
-
bioRxiv - Cancer Biology 2024Quote: ... Growth factors were also given to media surrounding basement membrane extract (Cultrex, Biotechne): 1% Mouse recombinant Noggin (Peprotech, UK), 1% mouse recombinant EGF (Invitrogen ...
-
bioRxiv - Immunology 2021Quote: ... Mouse recombinant IL-21 (PeproTech) was added to co-cultures at 10ng/ml ...
-
bioRxiv - Immunology 2021Quote: ... recombinant mouse IL-12 (Peprotech) and anti-IL-4 (BioXCell) ...
-
bioRxiv - Cell Biology 2021Quote: ... 10ng/mL mouse SCF (Peprotech) and 0.1% PVA (Sigma ...
-
bioRxiv - Cancer Biology 2022Quote: ... mouse SCF (20ng/µL, PeproTech), penicillin (100U/mL ...
-
bioRxiv - Cancer Biology 2022Quote: ... mouse IFN-γ from PeproTech; MRT68601 ...
-
bioRxiv - Neuroscience 2020Quote: ... The final pellets were dissociated with pre-warmed 10% fetal bovine serum in DMEM supplemented with 20 ng mL-1 mouse M-CSF (PeproTech) and plated in culture dishes ...
-
The skin environment controls local dendritic cell differentiation and function through innate IL-13bioRxiv - Immunology 2021Quote: ... were harvested and one million cells were resuspended in 1 mL of TCM in 24 wells plates and stimulated with recombinant mouse IL-13 (Peprotech) at a concentration of 100 ng/mL for 30 min at 37°C ...
-
bioRxiv - Immunology 2020Quote: ... the obtained bone marrow cells were cultured in RPMI-1640 containing 10% FBS and 10 ng mL−1 mouse macrophage colony-stimulating factor (M-CSF, Peprotech) in a humidified 5% CO2 atmosphere at 37 °C for six days ...
-
bioRxiv - Cancer Biology 2019Quote: ... Samples were examined by ELISA capturing with Fc-iNKG2D and detecting with biotinylated rabbit-anti-human IL-2 polyclonal antibody (Peprotech #500-P22BT) followed by incubation with streptavidin-HRP ...
-
bioRxiv - Immunology 2022Quote: A single cell suspension was prepared by flushing the bone marrow from the hind legs in RPMI containing 10% FCS buffer with 10 ng/mL IL6 (Peprotech, 216-16). A red blood cell lysis step was performed in 2 mL ammonium-chloride-potassium (ACK ...
-
bioRxiv - Biochemistry 2024Quote: ... Medium was replaced 24 h later with DMEM-10% FCS supplemented or not with 50 ng/ml human IL-1β (PeproTech, 200-01B). Luciferase activity was measured 5 h later using Bright-Glo Luciferase Assay System (Promega ...
-
bioRxiv - Developmental Biology 2021Quote: ... recombinant mouse RANKL (100ng/ml, Peprotech) was added to the media and incubated for 4 days.
-
bioRxiv - Molecular Biology 2021Quote: ... recombinant mouse RankL (100ng/ml, Peprotech) was added to the media and incubated for 4 days ...
-
bioRxiv - Immunology 2021Quote: ... 10ng/mL mouse M-CSF (Peprotech), seeded at 2×105 cells/mL and placed in polytetrafluoroethylene bags (Welch Fluorocarbon ...
-
bioRxiv - Cancer Biology 2019Quote: ... 100 ng/mL mouse Noggin (Peprotech) and 10% human R-spondin-1 (Peprotech)] was added to each well ...
-
bioRxiv - Cancer Biology 2019Quote: ... 50 ng/mL mouse EGF (Peprotech), 100 ng/mL mouse Noggin (Peprotech ...
-
bioRxiv - Immunology 2019Quote: ... 1ng/mL mouse interleukin 7 (Peprotech) and 5ng/mL mouse FMS-like tyrosine kinase 3 (Peprotech) ...
-
bioRxiv - Cancer Biology 2019Quote: ... mouse IFN-γ (PeproTech; #315-05) or control ...
-
bioRxiv - Cancer Biology 2022Quote: ... mouse IL-6 (10ng/µL, PeproTech), mouse IL-3 (10ng/µL ...
-
bioRxiv - Cancer Biology 2022Quote: ... mouse IL-3 (10ng/µL, PeproTech), mouse SCF (20ng/µL ...
-
bioRxiv - Biochemistry 2022Quote: ... 100 ng/mL mouse Noggin (Peprotech), 100 ng/mL human fibroblast growth factor-10 (FGF10 ...
-
bioRxiv - Developmental Biology 2022Quote: ... 1000 U/ml mouse LIF (Peprotech). Cells were seeded at a density of 2.5 x 105 per 10cm dish and grown over night (12h) ...
-
bioRxiv - Immunology 2020Quote: Mouse and human recombinant TNF (Peprotech), zVAD-fmk (Calbiochem and Bachem) ...
-
bioRxiv - Molecular Biology 2020Quote: ... recombinant mouse RankL (100ng/ml, Peprotech) was added to the media and incubated for 4 days ...
-
bioRxiv - Physiology 2020Quote: ... mouse IL-33 (Peprotech, #210-33), or mouse IL-13 (Peprotech ...
-
bioRxiv - Developmental Biology 2020Quote: ... Recombinant mouse LIF (PeproTech, TX, USA) was administered i.p at a concentration of 10 ug in PBS/mouse at E3.5 ...
-
bioRxiv - Cell Biology 2020Quote: ... mouse Epidermal growth factor (EGF, PeproTech), human basic Fibroblast growth factor (bFGF ...
-
bioRxiv - Cell Biology 2021Quote: ... purified human or mouse TRAIL (PeproTech), Paclitaxol or doxorubicin ...
-
bioRxiv - Cell Biology 2022Quote: ... 100 ng/mL Mouse Noggin (Peprotech) and 10% R-spondin-1 conditioned medium (lab production) ...
-
bioRxiv - Bioengineering 2023Quote: ... 50ng/ml mouse recombinant EGF (Peprotech), 100 ng/ml mouse recombinant noggin (Peprotech) ...
-
bioRxiv - Cancer Biology 2024Quote: ... 5 x 105 splenocytes from single cell suspensions were incubated with increasing concentrations of recombinant mouse IFNγ (0, 0.1, 1, 10, 100 ng/mL) for 48 hours (Peprotech, 315-05). Cells were then harvested and incubated with a panel of antibodies containing anti-mouse CD19 (Biolegend,115504) ...
-
bioRxiv - Neuroscience 2023Quote: ... cells were resuspended in 320 μl of fresh DRG media (F12, 10% hi-FBS, 1% Pen/Strep, 20 ng/ml mouse GDNF (Peprotech #450-44), 50 ng/ml mouse NGF (Peprotech #450-34) ...
-
bioRxiv - Cell Biology 2020Quote: ... Recombinant mouse CXCL12 was purchased from Peprotech. AMD3100 was purchased from Millipore Sigma ...
-
bioRxiv - Cancer Biology 2019Quote: ... 500ng of recombinant mouse (250-11; Peprotech) or human (300-11 ...
-
bioRxiv - Cancer Biology 2019Quote: ... or mouse IFN-γ (PeproTech; #315-05).
-
bioRxiv - Immunology 2022Quote: ... 20 ng/ml mouse GM-CSF (PeproTech), 10 ng/ml mouse IL-4 (PeproTech) ...
-
bioRxiv - Immunology 2022Quote: ... 10 ng/ml mouse IL-4 (PeproTech), 50 uM 2-mercaptoethanol] at 0.8×106 cells/ml ...
-
bioRxiv - Cancer Biology 2020Quote: ... plus 5 ng/ml mouse TNFα (PeproTech) were added and cells were incubated at 37°C in a humidified atmosphere with 5% CO2 for 6 days as described ...
-
bioRxiv - Genetics 2022Quote: ... 100 ng/ml recombinant mouse thrombopoietin (Peprotech), and 10 ng/ml recombinant mouse stem cell factor (Peprotech).
-
bioRxiv - Cancer Biology 2019Quote: ... 100 ng/ml mouse recombinant Noggin (Peprotech), 10% RSpo-1 conditioned medium [37] ...
-
bioRxiv - Pathology 2020Quote: ... 40 ng/ml mouse FGF-basic (PeproTech) (Ciccolini and Svendsen ...
-
bioRxiv - Physiology 2020Quote: ... or mouse IL-13 (Peprotech, #210-13) for the time specified before collection ...
-
bioRxiv - Neuroscience 2021Quote: ... and anti-mouse CD28 (clone #37.51, PeproTech) antibodies and incubated in IMEM medium supplemented with IL-2 at 37 °C ...
-
bioRxiv - Immunology 2020Quote: ... 100 ng/ml recombinant mouse Noggin (Peprotech), 50 ng/ml recombinant mouse EGF (BioLegend) ...