Labshake search
Citations for Peprotech :
51 - 100 of 633 citations for L Isoleucine N Fmoc 1 13C 99% since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Systems Biology 2019Quote: ... All in vitro T cell generation cultures were supplemented with 5ng/mL Flt3-L and 5 ng/mL IL-7 (Peprotech), and were sorted after 6 or 7 total days of culture before transducing with retroviral vectors or treating with small molecule inhibitors ...
-
bioRxiv - Immunology 2022Quote: ... 0.25 µg/mL Amphotericin B and 2 mM L-glutamine and treated with 10 ng/mL recombinant IL-12p70 (Peprotech) for 24 hours for supernatant IFN-γ analysis.
-
Combining LSD1 and JAK-STAT inhibition targets Down syndrome-associated myeloid leukemia at its corebioRxiv - Cancer Biology 2022Quote: ... and a cytokine cocktail (FLT3-L, SCF, IL-6, IL-3, TPO; all purchased from PeproTech, Rocky Hill, NJ, USA). Samples were taken from pediatric AML patients treated as part of the AML Berlin-Frankfurt-Münster study group ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Cell Biology 2023Quote: ... glutamine and human early-acting cytokines (SCF 300 ng/ml, Flt3-L 300 ng/ml, TPO 100 ng/ml, and IL-3 60 ng/ml; all purchased from Peprotech). All cultures were kept at 37°C in a 5% CO2 water jacket incubator (Thermo Scientific ...
-
bioRxiv - Immunology 2023Quote: ... filtered and cultured for 7 days in complete RPMI medium (RPMI-1640 medium containing L-glutamine plus 10% fetal calf serum) containing 20ng/mL recombinant GM-CSF (Peprotech).
-
bioRxiv - Neuroscience 2024Quote: ... NPC were plated on poly- L-ornithine/laminin-coated flasks at 50’000 cells/cm2 in2µg/ml laminin-supplemented neural expansion medium (DMEM/F-12 + Glutamax, Gibco®; 1x N-2 supplement, Gibco®; 1x B27 supplement without vitamin A, Gibco®; 10 ng/ml FGF-2, PeproTech; 10 ng/ml EGF, Miltenyi). NPC were then transduced with a VSV-G-pseudotyped lentivirus (carrying pCW57.1 plasmid from Addgene # 41393 (gift from David Root ...
-
bioRxiv - Cell Biology 2020Quote: ... from serial transplants were thawed and maintained in medium (DMEM with 15% FBS + 100 units/ml penicillin streptomycin and 2mM L-glutamine) and supplemented with 10ng/ml IL-3 (Peprotech, 213-13), 10ng/ml IL-6 (Peprotech 216-1 ...
-
bioRxiv - Cell Biology 2022Quote: ... cells were lifted using accutase and plated onto Laminin-111/ poly-L-ornithine-coated plates in NIM supplemented with 10 ng/ml BDNF (Peprotech, 450-02) and 10 ng/ml GDNF (Peprotech ...
-
bioRxiv - Cell Biology 2020Quote: ... were maintained in medium (RPMI with 20% FBS + 100 units/ml penicillin streptomycin and 2mM L-glutamine) and supplemented with 10ng/ml IL-3 (Peprotech, 213-13). For in vivo experiments ...
-
bioRxiv - Biochemistry 2022Quote: ... cells were diluted to a density of 6e4/mL and 50 μL (3e3 cells) were added to 50 μL of media containing 2x of a serial dilution of human CSF3 (PeproTech 300-23) in a 96-well plate ...
-
bioRxiv - Biochemistry 2022Quote: TNFR2-expressing RamosBlue cells were seeded at 5 × 104 cells/well in 100 μL of medium containing antibodies at the indicated concentrations in the absence or presence of 50 ng/mL TNFα (Peprotech #AF-200-01A). The cells were incubated for 18 h ...
-
bioRxiv - Molecular Biology 2020Quote: ... IGF-1 (100 ng ml-1; recombinant Human IGF-1, Peprotech, Cat#100-11 ...
-
bioRxiv - Immunology 2019Quote: ... rIL-4 (1 ng ml-1, Peprotech) was added to the primary culture for four days ...
-
bioRxiv - Bioengineering 2023Quote: ... 1 ng mL−1 BMP-6 (PeproTech), and 0.2 ng mL−1 basic FGF-2 (R&D systems) ...
-
bioRxiv - Immunology 2020Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Immunology 2022Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Cancer Biology 2023Quote: ... 1 ng/mL Neuregulin 1 (PeproTech, 100-03), 1.25 mmol/L N-acetylcysteine (Sigma Aldrich ...
-
bioRxiv - Immunology 2024Quote: ... 1 and 1 µg/mL (PeproTech, Cranbury, NJ) for 18 hours ...
-
bioRxiv - Bioengineering 2020Quote: ... 1% P/S supplemented with 20ng/mL insulin-like growth factor 1 (IGF-1, PeproTech). HDMC medium was replenished entirely at 48h intervals.
-
bioRxiv - Neuroscience 2019Quote: ... and insulin-like growth factor 1 (IGF-1, Peprotech). All cells were incubated at 37° in 5% CO2.
-
bioRxiv - Cell Biology 2022Quote: ... 1 ng ml-1 TGFβ3 (AF-100-36E, Peprotech), and 500 μM dibutyryl-cAMP (D0627 ...
-
bioRxiv - Bioengineering 2020Quote: ... 10 ng/mL fibroblast growth factor-1 (FGF-1; Peprotech), 5
-
bioRxiv - Bioengineering 2020Quote: ... insulin-like growth factor-1 (IGF-1, 20ng/mL; PeproTech) and hydrocortisone (1 μM ...
-
bioRxiv - Cell Biology 2019Quote: ... 10 ng/mL fibroblast growth factor-1 (FGF-1; Peprotech), and 5 μg/mL porcine heparin sodium salt (Sigma) ...
-
bioRxiv - Cancer Biology 2023Quote: ... 500 ng mL−1 mR-Spondin-1 (Peprotech 315-32), and 10 mM nicotinamide (Sigma N0636) ...
-
bioRxiv - Cell Biology 2023Quote: ... as well as IGF-1 (100 ng mL-1, Peprotech) and FGF-2 (50 ng mL-1 ...
-
bioRxiv - Cancer Biology 2022Quote: ... Transforming growth factor beta-1 (TGFb-1) was obtained from Peprotech.
-
bioRxiv - Cell Biology 2021Quote: ... 250 ng.mL-1 amphotericin B and 25 ng.mL-1 hM-CSF (PeproTech) for 5 to 7 days ...
-
bioRxiv - Immunology 2022Quote: ... mixed 1:1 with serial dilutions of either CXCL4 (Peprotech, Hamburg, Germany) or CXCL4L1 (ChromaTec ...
-
bioRxiv - Bioengineering 2021Quote: ... 1 % P/S and 1 ng/ml human FGF2 (Peprotech, 100-18B). When the MSCs reached 80-90 % confluency ...
-
bioRxiv - Cell Biology 2023Quote: ... TGFβ1 (cat. no. 100-21, Peprotech, 1 and 4 ng ml−1) and SB431442 (cat ...
-
bioRxiv - Molecular Biology 2020Quote: ... TGF-β 1(Peprotech) was added into the media at concentration of 10ng/ml ...
-
bioRxiv - Biochemistry 2020Quote: ... 1 μM forskolin (PeproTech), 1 μM Wnt-C59 (Bio-Techne Ltd. ...
-
bioRxiv - Cell Biology 2020Quote: ... 1 μM PGE2 (Peprotech), 50% Wnt3a (conditioned medium) ...
-
bioRxiv - Neuroscience 2022Quote: ... and IGF-1 (Peprotech), plated onto poly-D-lysine (100µg/ml ...
-
bioRxiv - Biophysics 2022Quote: ... EGF (Peprotech,1 mg): Resuspend at 100 ug/ml in sterile ddH2O and store aliquots at -20°C ...
-
bioRxiv - Developmental Biology 2023Quote: ... 1 μM PD0325901 (Peprotech) and 3 μM CHIR99021-at 37 °C and 5% CO2 incubating condition ...
-
bioRxiv - Cancer Biology 2019Quote: ... 20 ng ml-1 EGF and 20 ng ml-1 b-FGF (PeproTech) under adherent conditions ...
-
bioRxiv - Cell Biology 2021Quote: ... 40 ng/ml insulin-like growth factor 1 (IGF-1) (100-12, PeproTech), 1 μM dexamethasone (D2915 ...
-
bioRxiv - Pathology 2021Quote: ... and then stimulated with 1 ng/mL IL-1 beta (Peprotech, London, UK), and 10 μM CPA (Sigma) ...
-
bioRxiv - Cancer Biology 2023Quote: ... HISC media was supplemented with human R-spondin 1 (1 μg/ml; Peprotech), and NGS-WNT (0.5 M ...
-
bioRxiv - Cell Biology 2023Quote: ... 100 ng mL-1 and recombinant human Noggin 100 ng mL- 1 (Peprotech), as well as IGF-1 (100 ng mL-1 ...
-
bioRxiv - Immunology 2024Quote: ... at a 1:1 ratio and recombinant human IL-2 (Peprotech, ThermoFisher Scientific), and expanded in RPMI 1640 medium supplemented with 10% fetal bovine serum (FBS) ...
-
bioRxiv - Developmental Biology 2023Quote: ... 10ng/ml of recombinant human insulin-like growth factor 1 (IGF-1; Peprotech), and 200µM of 2-Mercaptoethanol (2-ME ...
-
bioRxiv - Immunology 2022Quote: ... Recombinant murine macrophage chemoattractant protein 1 (MCP-1) (20 ng/mL; Peprotech, NJ, USA) was used as a positive control ...
-
bioRxiv - Cancer Biology 2019Quote: ... 5nM NRG1 Heregulinβ-1 (Peprotech), 500 nM A83-01 (Sigma) ...
-
bioRxiv - Neuroscience 2021Quote: ... R-spondin 1 (Rspo1; Peprotech) was used at 50 ng/mL ...
-
bioRxiv - Neuroscience 2021Quote: ... 1 mM Dibutyryl-cAMP (PeproTech), 200 nM ascorbic acid (StemCell Technologies) ...