Labshake search
Citations for Peprotech :
551 - 600 of 1451 citations for Irisin Human Mouse Rat HEK293 Fc since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
The transcription factor RUNX2 drives the generation of human NK cells and promotes tissue residencybioRxiv - Immunology 2022Quote: After 48 hours of culture in preculture medium (complete IMDM medium supplemented with 10% FCS, stem cell factor (SCF) (100 ng/mL, Peprotech), FMS-like tyrosine kinase-3 ligand (FLT3-L ...
-
bioRxiv - Immunology 2020Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Immunology 2022Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Immunology 2021Quote: The differentiation of isolated monocytes into macrophages was performed in RPMI 1640 GlutaMAx medium with 10% FCS and 1% P/S containing 100 ng/mL macrophage colony-stimulating factor (M-CSF) (PeproTech) for 7 days ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2023Quote: ... mouse bone marrow was flushed and cultured for 2 days in stem cell medium (DMEM + 15% FCS + 25ng/ml SCF (PeproTech) + 10ng/ml IL-3 (PeproTech ...
-
bioRxiv - Cancer Biology 2021Quote: ... 20 ng/ml recombinant human GRO-α/MGSA (CXCL1; Peprotech), and 25 ng/ml recombinant human HGF (Peprotech) ...
-
bioRxiv - Cancer Biology 2021Quote: ... 20ng/ml Human FGF rec 154aa (Peprotech, GMP100-18 B), 10 ng/ml EGF (Sigma ...
-
bioRxiv - Cell Biology 2020Quote: ... 10 ng/mL recombinant human LIF (hLIF; Peprotech 300-05); 3 µM CHIR99021 (Tocris 4423) ...
-
bioRxiv - Cell Biology 2020Quote: Human recombinant TNF-α and RANK-L were from PeproTech. Mouse monoclonal antibody to glycoprotein-2 (Gp-2 ...
-
bioRxiv - Cell Biology 2020Quote: ... Human TGF-β was purchased from Peprotech (Rocky Hill, NJ). Cycloheximide ...
-
bioRxiv - Molecular Biology 2020Quote: ... human EGF 20 ng/mL (PeproTech, Rocky Hill, NJ, USA), tocopherol ...
-
bioRxiv - Developmental Biology 2020Quote: ... 20 ng/ml recombinant human ACTIVIN A (Peprotech 120-14E) and 8ng/ml bFGF (Peprotech).
-
bioRxiv - Neuroscience 2022Quote: ... 100 ng/ml Human IL34 (Peprotech; Cat. No. 200-34) and 10 ng/ml Human GM-CSF (Peprotech ...
-
bioRxiv - Molecular Biology 2020Quote: ... Recombinant human interleukin-2 (2 ng/ml, IL-2, Peprotech). Ficoll® lymphocyte separation medium (LSM ...
-
FOXO dictate initiation of B cell development and myeloid restriction in common lymphoid progenitorsbioRxiv - Immunology 2022Quote: ... 5ng/ml murine SCF and 5ng/ml human FL (PeproTech). Additional FL (5ng/ml ...
-
bioRxiv - Genomics 2020Quote: ... Recombinant human TGFβ (AF-100-21C) was purchased from PeproTech and was used at 25 ng/mL for 12 hours after 24 hours serum starvation of the cells.
-
bioRxiv - Developmental Biology 2019Quote: ... human recombinant R-spondin-1 500 ng/mL (PeproTech®), murine recombinant EGF 50 ng/mL (PeproTech® ...
-
bioRxiv - Immunology 2019Quote: ... and 50ng/ml recombinant human Macrophage colony-stimulating factor (Peprotech). Cells were placed into 6-well plates for stimulation with 10ng/ml Salmonella Minnesota R595 (Re ...
-
bioRxiv - Immunology 2019Quote: ... and 30 IU/mL recombinant human IL-2 (PeproTech Inc) in complete media for 5-7 days [142] ...
-
bioRxiv - Pathology 2019Quote: ... and Recombinant Human TGF-β1 (50ng/mL, Peprotech 100-21). Half media changes were performed every two days for 11 days.
-
bioRxiv - Cancer Biology 2020Quote: ... human fibroblast growth factor 10 (hFGF10, 100 nm/ml, Peprotech), and nicotinamide (10 mM ...
-
bioRxiv - Immunology 2021Quote: ... and 50ng/mL recombinant human GM-CSF (rhGM-CSF [PeproTech]). On day 2 ...
-
bioRxiv - Neuroscience 2021Quote: ... Recombinant human BDNF and IGF-I were purchased from PeproTech.
-
bioRxiv - Neuroscience 2021Quote: ... + N2 Supplement-A + 20 ng/ml recombinant human BDNF (Peprotech) + 20 ng/ml recombinant human GDNF (Peprotech ...
-
bioRxiv - Neuroscience 2021Quote: ... 1 ng/ml human brain-derived neurotrophic factor (BDNF; PeproTech) and 1% penicillin/streptomycin ...
-
bioRxiv - Cell Biology 2021Quote: ... Recombinant human TGFβ1 (#100-21C-10) was purchased from PeproTech. 20 μg ml-1 stock solution of TGFβ1 was made in 4 mM HCl containing 1 mg ml-1 bovine serum albumin ...
-
bioRxiv - Cancer Biology 2020Quote: ... recombinant human basic FGF 10 ng/mL (Peprotech, 100-18B) and 10% penicillin/streptomycin ...
-
bioRxiv - Cell Biology 2020Quote: ... 9.5 and 19 nM recombinant human visfatin (hrNAMPT(1)) (PeproTech), 1.9 and 9.5 nM recombinant human visfatin (hrNAMPT(2) ...
-
bioRxiv - Cancer Biology 2021Quote: ... Wells were treated in triplicate with soluble human TRAIL (PeproTech), or treated with the anti-DR4 agonist antibody Mapatumumab (Creative Biolabs ...
-
bioRxiv - Cell Biology 2021Quote: ... Recombinant Human TNF-alpha (300-01A) was purchased from Peprotech and used at 10 ng/ml for 20h (all other experiments ...
-
bioRxiv - Cancer Biology 2020Quote: ... 0.02 μg/mL recombinant human epidermal growth factor (EGF, Peprotech) and 15 mM HEPES-buffer ...
-
bioRxiv - Biochemistry 2022Quote: ... 100 ng/mL human fibroblast growth factor-10 (FGF10, Peprotech), 25 ng/mL human fibroblast growth factor-7 (FGF7 ...
-
bioRxiv - Biochemistry 2022Quote: ... 25 ng/mL human fibroblast growth factor-7 (FGF7, Peprotech), 1.25 mM N-acetyl cysteine (Sigma-Aldrich) ...
-
bioRxiv - Cancer Biology 2022Quote: ... with addition of human FGF-10 100 ng/ml (Peprotech) and no SB202190 in the culturing medium ...
-
bioRxiv - Cell Biology 2022Quote: ... 20 ng/ml human basic FGF-2 (#100-18B, PeproTech), 5 mg/ml Heparin (#H3149-50KU ...
-
bioRxiv - Cell Biology 2022Quote: ... 20 ng/ml human basic FGF-2 (#100-18B, PeproTech), 5mg/ml Heparin (#H3149-50KU ...
-
bioRxiv - Cell Biology 2022Quote: ... 20 ng/ml human basic FGF-2 (#100-18B, PeproTech), and 1x PSF (#15240062 ...
-
bioRxiv - Developmental Biology 2021Quote: ... 100 ng ml−1 human noggin (Peprotech; 120-10C-1000).
-
bioRxiv - Neuroscience 2021Quote: ... + N2 Supplement-A + 20 ng/ml recombinant human BDNF (Peprotech) + 20 ng/ml recombinant human GDNF (Peprotech ...
-
bioRxiv - Immunology 2020Quote: ... Recombinant human IFN-β (Peprotech, Rocky Hill, NJ, 300-02BC) was used to stimulate MHC class I expression.
-
bioRxiv - Cancer Biology 2020Quote: ... 10 ng/ml human basic fibroblast growth factor FGF (Peprotech), 20 IU/ml Heparin (Baxter ...
-
bioRxiv - Bioengineering 2021Quote: ... Recombinant Human Brain Derived Neurotrophic Factor (BDNF, PeproTech, 20ng/mL), Recombinant Human Glial-Derived Neurotrophic Factor (GDNF ...
-
bioRxiv - Bioengineering 2021Quote: ... Recombinant Human Glial-Derived Neurotrophic Factor (GDNF, PeproTech, 20ng/mL), dibutyryl cAMP (1mM ...
-
bioRxiv - Immunology 2022Quote: ... and recombinant human M-CSF (20 ng per ml; Peprotech) for 5-6 days ...
-
bioRxiv - Synthetic Biology 2022Quote: ... 10 ng/ml human recombinant TGF-β1 (Peprotech; 100-21). Following each split ...
-
bioRxiv - Zoology 2022Quote: ... with 10 ng/mL human Leukemia Inhibitory Factor (hLIF, Peprotech), unless stated otherwise ...