Labshake search
Citations for Peprotech :
101 - 150 of 155 citations for Cow Protein L Isoaspartate PCMT1 ELISA Kit since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2022Quote: ... cultured with bone morphogenetic protein 4 (BMP4, Peprotech, 120-05), vascular endothelial growth factor (VEGF ...
-
bioRxiv - Biochemistry 2023Quote: ... human recombinant IL-1β and TNF-α proteins from PeproTech (UK). A clinicaltrials.gov search on February 13 ...
-
bioRxiv - Cell Biology 2023Quote: ... 20 ng/mL Bone Morphogenetic Protein 4 (rBMP4, (PeproTech, 120-05) and 10 ng/mL FGF2 and cultured for 3 days ...
-
bioRxiv - Biochemistry 2023Quote: ... Recombinant Human IL-6 protein was purchased from Peprotech (Cranbury, USA) Albumin from human serum (HSA ...
-
bioRxiv - Neuroscience 2022Quote: To obtain neural rosettes the EBs were seeded on poly-l-ornithine/laminin (POLAM) coated plates with PN medium supplemented with Noggin (200ng/ml; Peprotech) and SB431542 (10 μM ...
-
bioRxiv - Systems Biology 2019Quote: ... All in vitro T cell generation cultures were supplemented with 5ng/mL Flt3-L and 5 ng/mL IL-7 (Peprotech), and were sorted after 6 or 7 total days of culture before transducing with retroviral vectors or treating with small molecule inhibitors ...
-
bioRxiv - Immunology 2022Quote: ... 0.25 µg/mL Amphotericin B and 2 mM L-glutamine and treated with 10 ng/mL recombinant IL-12p70 (Peprotech) for 24 hours for supernatant IFN-γ analysis.
-
Combining LSD1 and JAK-STAT inhibition targets Down syndrome-associated myeloid leukemia at its corebioRxiv - Cancer Biology 2022Quote: ... and a cytokine cocktail (FLT3-L, SCF, IL-6, IL-3, TPO; all purchased from PeproTech, Rocky Hill, NJ, USA). Samples were taken from pediatric AML patients treated as part of the AML Berlin-Frankfurt-Münster study group ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Immunology 2023Quote: ... and cultured in complete RPMI 1640 media (10% fetal bovine serum, 1% penicillin-streptomycin, 1% L-glutamine) supplemented with 10 ng/mL M-CSF (PeproTech). Cells were cultured for 5 days at 37°C in a humidified 5% CO2 atmosphere under continuous high-dose 100 ng/mL lipopolysaccharide (LPS ...
-
bioRxiv - Immunology 2023Quote: ... filtered and cultured for 7 days in complete RPMI medium (RPMI-1640 medium containing L-glutamine plus 10% fetal calf serum) containing 20ng/mL recombinant GM-CSF (Peprotech).
-
bioRxiv - Cell Biology 2023Quote: ... glutamine and human early-acting cytokines (SCF 300 ng/ml, Flt3-L 300 ng/ml, TPO 100 ng/ml, and IL-3 60 ng/ml; all purchased from Peprotech). All cultures were kept at 37°C in a 5% CO2 water jacket incubator (Thermo Scientific ...
-
bioRxiv - Developmental Biology 2021Quote: ... Bone morphogenetic protein 2 (BMP2, 100-200 ng/mL; Peprotech #120-02), Bone morphogenetic protein 4 (BMP4 ...
-
bioRxiv - Developmental Biology 2021Quote: ... Bone morphogenetic protein 7 (BMP7, 100-200 ng/mL; Peprotech #120-03P), Fibroblast growth factor-2 (FGF2 ...
-
bioRxiv - Developmental Biology 2021Quote: ... Bone morphogenetic protein 4 (BMP4, 100-200 ng/mL; Peprotech #315-27), Bone morphogenetic protein 7 (BMP7 ...
-
bioRxiv - Cell Biology 2024Quote: 0.15 ug/ml of recombinant mouse protein CXCL9 (Peprotech, Cat #: 250-18) and 0.1 ug/ml of recombinant mouse protein CXCL10 (Peprotech ...
-
bioRxiv - Molecular Biology 2019Quote: ... WNT3A recombinant protein (Cat#315-20) was purchased from PeproTech (Rocky Hill, NJ). WNT8A (Cat#8419-WN-010/CF ...
-
bioRxiv - Cell Biology 2023Quote: ... Recombinant HCC-1 protein (20ng/ml, PP-300-38B-2, Peprotech, United States) was added to cell culture medium ...
-
bioRxiv - Cell Biology 2024Quote: ... and 0.1 ug/ml of recombinant mouse protein CXCL10 (Peprotech, Cat #: 250-16) pure ligands were plated in the bottom well of a 96 well transwell (Corning ...
-
bioRxiv - Bioengineering 2023Quote: ... recombinant human Wnt-7a protein (PeproTech, cat# 120-31, 10-300 ng/mL), lithium chloride (LiCl ...
-
bioRxiv - Cell Biology 2020Quote: ... from serial transplants were thawed and maintained in medium (DMEM with 15% FBS + 100 units/ml penicillin streptomycin and 2mM L-glutamine) and supplemented with 10ng/ml IL-3 (Peprotech, 213-13), 10ng/ml IL-6 (Peprotech 216-1 ...
-
bioRxiv - Cell Biology 2022Quote: ... cells were lifted using accutase and plated onto Laminin-111/ poly-L-ornithine-coated plates in NIM supplemented with 10 ng/ml BDNF (Peprotech, 450-02) and 10 ng/ml GDNF (Peprotech ...
-
bioRxiv - Developmental Biology 2021Quote: ... LCDMYI supplementation was added as indicated at the following concentrations: 10 ng ml−1 recombinant human LIF (L, 10 ng ml−1; Peprotech, 300-05), CHIR99021 (C ...
-
bioRxiv - Cell Biology 2020Quote: ... were maintained in medium (RPMI with 20% FBS + 100 units/ml penicillin streptomycin and 2mM L-glutamine) and supplemented with 10ng/ml IL-3 (Peprotech, 213-13). For in vivo experiments ...
-
bioRxiv - Biochemistry 2022Quote: ... cells were diluted to a density of 6e4/mL and 50 μL (3e3 cells) were added to 50 μL of media containing 2x of a serial dilution of human CSF3 (PeproTech 300-23) in a 96-well plate ...
-
bioRxiv - Bioengineering 2021Quote: ... 100 ng/mL human recombinant Bone Morphogenic Protein 4 (BMP4, Peprotech, AF-120-05ET), 100 ng/mL animal-free recombinant human Stem Cell Factor (SCF ...
-
bioRxiv - Immunology 2022Quote: ... Recombinant murine macrophage chemoattractant protein 1 (MCP-1) (20 ng/mL; Peprotech, NJ, USA) was used as a positive control ...
-
bioRxiv - Cell Biology 2023Quote: ... and the interferon gamma recombinant protein (300-02) from Peprotech (Rocky Hill, NJ, USA), TOTO-3 (T-3604) ...
-
bioRxiv - Developmental Biology 2023Quote: ... 5 nM recombinant human bone morphogenetic protein 4 (BMP4; Peprotech, # AF-120-05ET, USA) and 2 µM Smoothened agonist (SAG ...
-
bioRxiv - Immunology 2023Quote: To evaluate protein phosphorylation in CD8 T cells after stimulation with IFN-β (Peprotech), day 4 CTL were washed twice in serum-free media and incubated for 2 hours under serum and cytokine deprivation before stimulation ...
-
bioRxiv - Immunology 2022Quote: ... On day 7 macrophages were harvested and then maintained in 20 ng ml−1 CSF-1 for subsequent experiments in which they were either maintained in medium without any further additions (M0) or with addition of 20 ng ml−1 IL-4 (Peprotech; MI(L-4)) ...
-
bioRxiv - Biochemistry 2022Quote: TNFR2-expressing RamosBlue cells were seeded at 5 × 104 cells/well in 100 μL of medium containing antibodies at the indicated concentrations in the absence or presence of 50 ng/mL TNFα (Peprotech #AF-200-01A). The cells were incubated for 18 h ...
-
bioRxiv - Cancer Biology 2022Quote: ... Cells were afterwards stimulated with indicated amount of recombinant protein CXCL2 (250-15-20, PeproTech GmbH) in DMEM medium without FCS or conditioned medium of endothelial cells.
-
bioRxiv - Cancer Biology 2023Quote: ... or c) supplemented with recombinant human IGFBP5 protein (500 ng/ml; Peprotech, Rocky Hill, NJ, USA). Cell lysates were obtained using RIPA buffer with the Halt Protease and Phosphatase Inhibitor Cocktail (Thermo Fisher ...
-
bioRxiv - Cell Biology 2020Quote: ... the organoids were grown in DM supplemented with bone morphogenetic protein 4 (BMP4) (50 ng/mL, PeproTech) or Purmorphamine (1 μm ...
-
bioRxiv - Cell Biology 2019Quote: ... and bone morphogenetic protein-2 (BMP2) 300 ng/ml (Peprotech, cat. # 120-02-2UG, Rocky Hill, NJ). The SSC used for differentiation experiments were no older than passage 3 in culture.
-
bioRxiv - Neuroscience 2022Quote: ... IL-34 (100 ng/mL) and GM-CSF (10 ng/mL) (all protein growth factors were from Peprotech). Prior to thaw ...
-
bioRxiv - Bioengineering 2023Quote: ... then for the next 4 days media was supplemented with 50ng/mL bone morphogenetic protein 4 (BMP4) (Peprotech), and for the final 4 days 50ng/mL of hepatocyte growth factor (HGF ...
-
bioRxiv - Neuroscience 2021Quote: ... Cells were treated with either vehicle (equal volume added of 0.1% BSA in H2O) or 100nM BDNF recombinant protein (Peprotech, #450-02 ...
-
bioRxiv - Immunology 2020Quote: ... Strips were washed with TBS-T (TBS, 0.1% Tween-20) and bound protein was detected with specific rabbit anti-chemokine antibodies (Peprotech) followed by an HRP-conjugated anti-rabbit antibody (Abcam ...
-
bioRxiv - Neuroscience 2020Quote: Treatment of primary neurons - The primary neurons were treated with APOE from conditioned media or recombinant APOE protein (350-02, 350-04, Peprotech). For conditioned media treatment ...
-
The logic of native enhancer-promoter compatibility and cell-type-specific gene expression variationbioRxiv - Genomics 2022Quote: ... in N2B27 supplemented with 20ng/ml Activin A and 12ng/ml Fibroblast growth factor 2 (FGF2) (MPI-CBG protein facility, or Peprotech) for 14-15 passages ...
-
bioRxiv - Immunology 2022Quote: ... mice were repeatedly immunized every 14 days (5 times) subcutaneously (s.c.) into the flank with 10μg of human TNFR2 protein (Peprotech, 310-12) and 20μg MPLA (Sigma ...
-
bioRxiv - Immunology 2021Quote: ... a 6-week-old C57BL/6 mouse was repeatedly immunized 5 times every other week subcutaneously (s.c.) into the flank with 10ug of human TNFR2 protein (Peprotech, 310-12)/20ug MPLA (Sigma ...
-
bioRxiv - Neuroscience 2021Quote: ... Cells were dissociated using 5mM EDTA in HBSS and resuspended in media with B-27 supplement for 4 hours before incubation with recombinant BDNF protein (100nM, Peprotech, #450-02) or vehicle (equal volume of 0.1% BSA in H2O) ...
-
bioRxiv - Physiology 2019Quote: ... Cells were then serum starved in DMEM culture media with 2% BGS and the conditioned culture was supplemented with 200ng/ml of murine IL-10 recombinant protein (Peprotech, Rocky Hill, NJ). After 48 hours ...
-
bioRxiv - Bioengineering 2021Quote: ... supplemented with 50 ng/mL FGF2 and 30 ng/mL animal-free recombinant human Bone Morphogenic Protein 4 (BMP4, Peprotech, AF-120-05ET) for 24 hours ...
-
bioRxiv - Neuroscience 2021Quote: ... yolk sac embryoid bodies (YS-EBs) were generated by treating EBs with bone morphogenetic protein 4 (BMP4, 50 ng/ml, Peprotech; to induce mesoderm), stem cell factor (SCF ...
-
bioRxiv - Neuroscience 2019Quote: ... the yolk sac embryoid bodies (YS-EBs) were generated by treating the EBs with bone morphogenetic protein 4 (BMP4, 50 ng/ml, Peprotech; to induce mesoderm), vascular endothelial growth factor (VEGF ...