Labshake search
Citations for Peprotech :
301 - 350 of 438 citations for N BOC 3 FLUORO L TYROSINE since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Neuroscience 2022Quote: ... Sensory neuron media was supplemented with NT-3 (10ng/mL, PeproTech, 450-03), BDNF (10ng/mL ...
-
bioRxiv - Neuroscience 2023Quote: ... organoids were cultured in NDM supplemented with BDNF and NT-3 (both PeproTech; Thermo Fisher Scientific ...
-
bioRxiv - Cancer Biology 2024Quote: ... 2 and 1 ng/ml murine interleukin 3 (PeproTech, Rocky Hill, NJ, USA), respectively ...
-
bioRxiv - Immunology 2020Quote: ... L-glutamine and antibiotics and containing 10ng/mL recombinant human IL-7 and IL-15 (Peprotech, USA).
-
bioRxiv - Developmental Biology 2021Quote: ... The first 3 days in GMEM containing 100 ng/ml SCF (Peprotech, 250-03), 10 µM forskolin (Sigma-Aldrich ...
-
bioRxiv - Bioengineering 2021Quote: ... and 10 ng/ml human transforming growth factor-beta (TGF-b) 3 (PeproTech Ltd). Cells were cultured at 5% pO2 for at least 21 days and up to 8 weeks with medium change performed every two days
-
bioRxiv - Bioengineering 2021Quote: ... SI = 100 ng/mL murine SCF + 10 ng/mL murine IL-3 (both Peprotech)) was added per well and cells were cultured at 37°C and 5% CO2 ...
-
bioRxiv - Cell Biology 2022Quote: ... and antibiotics with or without 2i- PD0325901 (1 mM) and CHIR99021 (3 mM) (PeproTech). All the cells were maintained in a humidified incubator at 37°C and 6% CO2 ...
-
bioRxiv - Immunology 2019Quote: ... Human blood-derived macrophages were treated for 3 hours with 20ng/ml TNF (Peprotech) and/or 280nM PGE2 (Sigma-Aldrich) ...
-
bioRxiv - Immunology 2022Quote: ... interleukin-3 and interleukin-6 (each at 10 ng/ml, Peprotech, Rocky Hill, NJ). SCF was prepared as described previously (Negoro et al. ...
-
bioRxiv - Neuroscience 2022Quote: ... brain-derived neurotrophic factor (BDNF) and neurotrophin 3 (NT3) (PeproTech, Rocky Hill, NJ, USA). Induced neurons were fed with 50:50 mixture of astrocyte conditioned medium (provided by Dr ...
-
bioRxiv - Neuroscience 2022Quote: ... human NT-3 (10 ng/ml, catalog#450-03, PeproTech, East Windsor, NJ, USA), mouse laminin (0.1 µg/ml ...
-
bioRxiv - Cancer Biology 2024Quote: ... 1% P/S and 2 ng/mL human IL-3 (PeproTech, AF-300-23). TF-1 cells52 were cultured in RPMI-1640 medium supplemented with 10% FBS ...
-
bioRxiv - Developmental Biology 2021Quote: ES-to-DE (3 d): hESCs were exposed to 100 ng/ml Activin A (PeproTech) and 25 ng/ml Wnt-3a (PeproTech ...
-
bioRxiv - Neuroscience 2020Quote: ... with vehicle (5 mM sodium citrate buffer) or leptin (3 mg/kg body weight, Peprotech) according to the following scheme ...
-
bioRxiv - Cell Biology 2021Quote: ... media was supplemented with IL-1α (3 ng/mL; Peprotech cat. no. AF-200-01A), TNF (30 ng/mL ...
-
bioRxiv - Cell Biology 2021Quote: ... murine IL-3 (213-13) and Recombinant Human EPO (100-64) were obtained from PeproTech.
-
bioRxiv - Cell Biology 2020Quote: ... Wells were washed 3 times with PBS-T and further incubated with hrNAMPT(1) (Peprotech) at increasing concentration (0 nM to 800 nM ...
-
bioRxiv - Immunology 2022Quote: ... in 3 mL complete medium supplemented with 20 ng/mL murine recombinant GM-CSF (PeproTech). Cells were incubated in a 37°C and 5% CO2 incubator ...
-
bioRxiv - Immunology 2019Quote: ... Recombinant murine cytokines (IL-3, IL-5, IL-9, GM-CSF, SCF) were from Peprotech.
-
bioRxiv - Developmental Biology 2021Quote: ... TPO was replaced by 3 U/mL erythropoietin (EPO) (PeproTech,100-64, Cranbury, NJ, USA). On day 14 ...
-
bioRxiv - Genomics 2021Quote: ... in a 3:1 beads:cells ratio and 100 U/mL recombinant human IIL-2 (Peprotech). Non-tissue culture treated 12-well plates were prepared by incubating 1 mL PBS + 25 μg/mL Retronectin (Takara ...
-
bioRxiv - Genomics 2021Quote: ... in a 3:1 beads:cells ratio and 100 U/mL recombinant human IL-2 (Peprotech).
-
bioRxiv - Cell Biology 2024Quote: ... BMP-2/4) (ERB medium)3 or adding 10 ng/ml human IL-22 (Peprotech) in WENRA4 (Wnt/ R-spondin1 ...
-
bioRxiv - Molecular Biology 2023Quote: ... the medium was enriched with the cytokines mIL-3 (10 ng/ml) (213-13; PeproTech), mIL-6 (50 ng/ml ...
-
bioRxiv - Neuroscience 2023Quote: ... 1 ng/ml transforming growth factor-beta 3 (TGF-β3, Peprotech cat. no 100-36E) in the presence of 1 µM purmorphamine ...
-
bioRxiv - Neuroscience 2024Quote: ... bEnd.3 monolayers were incubated with stem cell factor (SCF) (PeproTech, Rocky Hill, NJ, USA) and/or granulocyte colony-stimulating factor (G-CSF ...
-
bioRxiv - Neuroscience 2022Quote: To obtain neural rosettes the EBs were seeded on poly-l-ornithine/laminin (POLAM) coated plates with PN medium supplemented with Noggin (200ng/ml; Peprotech) and SB431542 (10 μM ...
-
bioRxiv - Systems Biology 2019Quote: ... All in vitro T cell generation cultures were supplemented with 5ng/mL Flt3-L and 5 ng/mL IL-7 (Peprotech), and were sorted after 6 or 7 total days of culture before transducing with retroviral vectors or treating with small molecule inhibitors ...
-
bioRxiv - Immunology 2022Quote: ... 0.25 µg/mL Amphotericin B and 2 mM L-glutamine and treated with 10 ng/mL recombinant IL-12p70 (Peprotech) for 24 hours for supernatant IFN-γ analysis.
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Immunology 2023Quote: ... and cultured in complete RPMI 1640 media (10% fetal bovine serum, 1% penicillin-streptomycin, 1% L-glutamine) supplemented with 10 ng/mL M-CSF (PeproTech). Cells were cultured for 5 days at 37°C in a humidified 5% CO2 atmosphere under continuous high-dose 100 ng/mL lipopolysaccharide (LPS ...
-
bioRxiv - Developmental Biology 2024Quote: ... All in vitro T cell generation cultures were supplemented with 5ng/mL Flt3-L and 5 ng/mL IL-7 (Peprotech). Experiments involving in vitro generation of NK and ILC populations (Figures 3 ...
-
bioRxiv - Immunology 2024Quote: ... filtered and cultured for 7 days in complete RPMI medium (RPMI-1640 medium containing L-glutamine plus 10% fetal calf serum) containing 20ng/mL recombinant GM-CSF (Peprotech).
-
bioRxiv - Neuroscience 2024Quote: ... and replated at 50000-75000 cells/cm2 in a poly-L-ornithin-laminin coated 6-well plate with neurobasal medium supplemented with 10 ng/ml PDGFaa (Peprotech), 10 ng/ml IGF1 (Peprotech) ...
-
bioRxiv - Neuroscience 2020Quote: ... media was refreshed every other day with neural medium containing 20 ng/mL NT-3 (Peprotech) and 20 ng/mL BDNF (R&D) ...
-
bioRxiv - Bioengineering 2022Quote: ... 0.1% BSA Fraction V [Gemini Bio]) supplemented with CK+DCIR additives (3 μM CHIR99021 [CHIR; PeproTech] ...
-
bioRxiv - Immunology 2021Quote: ... IFNλ 2 (IL28A) (#300-2K) and IFNλ 3 (IL-28B) (#300-2K) were purchased from Peprotech. The IFN concentrations used to treat the cells and the duration of the treatments are stated in the figure legends.
-
bioRxiv - Developmental Biology 2020Quote: ... 1% penicillin-streptomycin and with or without 2i-PD0325901 (1 μM) and CHIR99021 (3 μM) (PeproTech). All TSCs and iTSCs were grown in TSC medium containing a combination of 70% MEF conditioned medium and 30% freshly prepared medium ...
-
bioRxiv - Immunology 2022Quote: ... 20 ng/ml recombinant IL-3 and 20 ng/ml stem cell factor (Peprotech Nordic, Sweden).
-
bioRxiv - Cell Biology 2022Quote: ... which was further supplemented with 10 ng/mL each of IL-3 (Peprotech, Cat#200-03), CSF-1 (Peprotech ...
-
bioRxiv - Immunology 2022Quote: ... These cells were cultured for 3 days in media containing 20 ng/ml IL-12 (Peprotech), 50 ng/ml IL-2 ...
-
bioRxiv - Neuroscience 2023Quote: ... the organoid maturation media was supplemented with 20 ng/ml of NT-3 (PeproTech, #450-03) and 20 ng/ml BDNF ...
-
bioRxiv - Immunology 2024Quote: Recombinant mouse TNF (Cat# 315-01A) and IL-3 (Cat# 213-13) were procured from Peprotech. The mouse monoclonal antibody to mouse TNF (MAb ...
-
bioRxiv - Immunology 2023Quote: Recombinant mouse TNF (Cat#315-01A) and IL-3 (Cat#213-13) were purchased from Peprotech. FBS (Cat# SH30396 ...
-
bioRxiv - Physiology 2024Quote: ... the flasks were stimulated for 3 days with 30ng/ml M-CSF (Cat# 315-02, Peprotech) and then ...
-
bioRxiv - Cancer Biology 2021Quote: ... and supplemented with murine SCF (10 ng/ml) and IL-3 (10 ng/ml) (Peprotech or BioLegend). The cells were serially passaged for ∼1 month ...
-
bioRxiv - Synthetic Biology 2021Quote: ... was added for 3 days at which point neurons were supplemented with 10µg/ml BDNF (Peprotech, USA) and lifted with accutase ...
-
bioRxiv - Microbiology 2021Quote: ... cells were starved of FBS for 3 h and stimulated with TNF-α (40 ng/ml, PeproTech) in FBS-free DMEM for 0 ...