Labshake search
Citations for Peprotech :
1901 - 1950 of 5884 citations for 2 4 6 Trichlorophenol 13C6 99% 100 Ug Ml In Isooctane since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2023Quote: ... FGF-4 (Peprotech) 100 ng mL-1 and recombinant human Noggin 100 ng mL- 1 (Peprotech) ...
-
bioRxiv - Immunology 2021Quote: ... for 4 days at 37°C in complete RPMI medium supplemented with 10 ng/mL recombinant mouse IL-5 (PeproTech) and 20 ng/mL IL-2 (402-ML R&D) ...
-
bioRxiv - Immunology 2021Quote: ... for 4 days at 37°C in complete RPMI medium supplemented with 10 ng/mL recombinant mouse IL-5 (PeproTech) and 20 ng/mL IL-2 (402-ML R&D) ...
-
bioRxiv - Neuroscience 2020Quote: ... Purified OPCs were expanded in poly-d-lysine coated flasks for 4-5 days in SATO serum-free media containing Platelet-Derived Growth Factor-AA (PDGF-AA, 10 ng/ml, PeproTech), neurotrophin-3 (NT-3 ...
-
bioRxiv - Microbiology 2019Quote: ... Purified CD14+ monocytes were cultured in complete RPMI supplemented with 100ng/mL each of recombinant human IL-4 and GM-CSF (PeproTech) at a cell density of 2e6 cells/mL ...
-
bioRxiv - Cancer Biology 2020Quote: Human liver organoid cultures derived from healthy and HBV infected livers were seeded and cultured for 4 days in EM without Wnt3a-conditioned medium supplemented with 25ng/ml of BMP7 (Peprotech). Hepatic differentiation was induced by culturing human liver organoids in differentiation medium (DM ...
-
bioRxiv - Microbiology 2019Quote: ... Purified CD14+ monocytes were cultured in complete RPMI supplemented with 100ng/mL each of recombinant human IL-4 and GM-CSF (PeproTech) at a cell density of 2e6 cells/mL ...
-
bioRxiv - Immunology 2021Quote: 750 000 MCs were either FACS-sorted after 24h of coculture with resting or anti-CD3/28 coated beads-activated effector/memory CD4+ T cells or stimulated for 4 hours with 10 ng/mL of IL-33 (Peprotech) or with 100 ng/mL of DNP-BSA (thermo-fischer scientific) ...
-
bioRxiv - Immunology 2022Quote: ... Th2 cells were generated by activating naïve CD4+ T cells with 1 μg/mL anti-CD3ε/3 μg/mL anti-CD28 for 3 days in complete T cell medium supplemented with 250U recombinant IL-4 (PeproTech), 6 μg/mL anti-IL-12 (BioXcell) ...
-
bioRxiv - Molecular Biology 2023Quote: ... followed by an additional 4 hours with or without an apoptotic stimulus of 10 ng/ml TNFα (Peprotech, Cranbury, NJ) and 20 μg/mL cycloheximide (Sigma-Aldrich ...
-
bioRxiv - Immunology 2023Quote: ... Cultures were changed on day 4 to new complete RPMI 1640 medium containing recombinant murine IL-5 (10 ng/ml, Peprotech) and further fed with IL-5 every other day between days 10 to 14 ...
-
bioRxiv - Biochemistry 2023Quote: ... cells were plated (60,000 cells/well in 24-well plates) two days before treatment in complete media supplemented with 25 ng/mL murine IL-4 (Peprotech) for M2-polarization or without any cytokines (M0) ...
-
bioRxiv - Cell Biology 2021Quote: ... The cell pellet was resuspended in 0.5 mL pre-warmed ‘plating’ media supplemented with 100 ng/μL NGF (Peprotech). Cells from all spines were pooled before plating in microfluidic devices (MFDs ...
-
bioRxiv - Genetics 2022Quote: ... The medium was changed for complete growth medium containing TGF-β (10 ng/ml, Cat#100-21, PeproTech, USA) and IL-1β (1ng/ml ...
-
bioRxiv - Cell Biology 2019Quote: ... F10 medium supplemented with 20% horse serum and 5 ng/ml basic fibroblast growth factor (bFGF; PeproTech 100-18B). After 6 days of culture ...
-
bioRxiv - Biochemistry 2021Quote: ... they were cultured in the presence of 0.5% FBS for the last 24 h and then incubated with 100-ng/ml human EGF (PeproTech) at 37°C for 5 min.
-
bioRxiv - Cell Biology 2022Quote: ... the aggregates were collected by gravitation and plated in N2B27 media supplemented with 100ng/ml VEGFA (Peprotech, 100-20) and 2 μM Forskolin (R&D system ...
-
bioRxiv - Neuroscience 2023Quote: ... and 100 ng/mL of CX3CL1 (Fractalkine/ chemokine (C-X3-C motif) ligand 1) (Peprotech, Catalog No. 300-31) for up to 12 days.
-
bioRxiv - Immunology 2019Quote: ... IL-2 (at a final concentration of 200 IU per ml and murine CXCL11 (Peprotech, Rocky Hill, NJ) at a final concentration of 2.7 mg/ml were added to the collagen mixture ...
-
bioRxiv - Immunology 2022Quote: ... cells were allowed to proliferate for two additional days by activation with 50 U/ml IL-2 (Peprotech) and 10% HS and 10% FBS ...
-
bioRxiv - Genetics 2021Quote: ... T cells were transferred to the culture medium supplemented with 30 IU/mL IL-2 (Peprotech, 200-02A). After electroporation for 3 days ...
-
bioRxiv - Immunology 2021Quote: ... diluted in complete RPMI (cRPMI; RPMI supplemented with 10% FBS plus recombinant human IL-2 (20IU/ml; Peprotech), as previously described.65,66 Activated cells were incubated for six days with a media change on day three.
-
bioRxiv - Immunology 2021Quote: ... in complete RMPI medium supplemented with the recombinant murine 1,000 U/ml IL-2 (PeproTech, Rocky Hill, NJ) and cultured for 5 days ...
-
bioRxiv - Immunology 2022Quote: ... and 2 mM glutamine (no BCS) with or without 10 ng/ml TGF-β1 (PeproTech, Rocky Hill, NJ). After 48 hours ...
-
bioRxiv - Biochemistry 2023Quote: ... The expression of IL-6 in culture supernatants was detected using the Murine IL-6 Mini ABTS ELISA Development Kit (PeproTech, 900-M50) according to the manufacturer’s protocol.
-
bioRxiv - Cell Biology 2021Quote: ... Macrophages were then skewed towards the M2 phenotype using recombinant human IL-4 (20 ng/ml) (Peprotech, Cat#AF-200-04), IL-13 (20 ng/ml ...
-
bioRxiv - Neuroscience 2022Quote: ... qNSCs were treated with aNSC media with the addition of 0.5 μg/mL of the BMP-4 antagonist noggin (PeproTech 120-10C) to more reproducibly induce quiescence exit.
-
bioRxiv - Developmental Biology 2020Quote: ETV2-ECs and ETV2-SPI1-ECs were cultured on coverslips until day 12 of differentiation with VEGFA (50ng/ml) (cat. 100-20, Peprotech). BALB/c LSECs were cultured for 1.5-2 hours after isolation ...
-
bioRxiv - Immunology 2022Quote: ... we thawed cryopreserved TCRα/β-depleted BM fractions at 37°C and cultured them overnight in SFEM containing 100 ng/mL human stem cell factor (SCF, Peprotech), 100 ng/mL human Fms-related tyrosine kinase 3 (FLT3 ...
-
bioRxiv - Molecular Biology 2019Quote: ... MLO-Y4 cells were treated with the following reagents in serum-free media: 5 ng/ml TGFβ1 (Peprotech, 100-36E), 0.1 μM PGE2 (Sigma) ...
-
bioRxiv - Neuroscience 2020Quote: ... Medium was replaced on the next day by Neuronal Expansion-XF Medium supplemented with EGF (20 ng/ml; AF-100-15, Peprotech) and FGF (20 ng/ml ...
-
bioRxiv - Bioengineering 2021Quote: ... and vascular endothelial growth factor (VEGF) (Catalog No. 100-20, Recombinant Human VEGF165, Peprotech, Rocky Hill, NJ, 0.1 μg/mL). A mixture of heparin ...
-
bioRxiv - Bioengineering 2021Quote: Lyophilized 90 % PEGDMA microrods were loaded by resuspending ∼100,000 (100 k) microrod aliquots in 20 μL of 1 mg/mL recombinant human β-NGF (Peprotech) as described in the Protein loading of PEGDMA microrods section ...
-
bioRxiv - Biochemistry 2022Quote: ... HeLa cells at a plate confluence of 80% were treated for 10 min with 100 ng/mL animal-free recombinant human EGF (PeproTech) or Gibco™ distilled water (Thermo Fisher Scientific ...
-
bioRxiv - Molecular Biology 2022Quote: ... and cultured for 8 days in differentiation medium (DMEM F12, 10% KOSR, with 1% NEAA and 1% Glutamine) containing 100 ng/mL of HGF (Peprotech) and 1% DMSO (Sigma Aldrich) ...
-
The transcription factor RUNX2 drives the generation of human NK cells and promotes tissue residencybioRxiv - Immunology 2022Quote: After 48 hours of culture in preculture medium (complete IMDM medium supplemented with 10% FCS, stem cell factor (SCF) (100 ng/mL, Peprotech), FMS-like tyrosine kinase-3 ligand (FLT3-L ...
-
bioRxiv - Neuroscience 2020Quote: ... Expansion of the neural progenitor cells was carried out in Neural Expansion Media (NEM) which is composed of NBM supplemented with FGF (10ng/ml) (100-18C, Peprotech) and EGF (10ng/ml ...
-
bioRxiv - Microbiology 2020Quote: ... On DIV 10 add 100% N2 medium plus recombinant human Brain Derived Neurotrophic Factor 10ng/ml (BDNF 450-02; Peprotech); Glial-Derived Neurotrophic Factor 10ng/ml (GDNF 450-10 ...
-
bioRxiv - Cancer Biology 2019Quote: Transformation assay was performed by removing IL-3 through centrifugation and adding 50 ng/mL human HGF (Peprotech 100-39H). For proliferation assays cells were seeded in 96-well plates at 5,000 cells/well and the following day were exposed to crizotinib (Selleck Chemicals ...
-
bioRxiv - Immunology 2020Quote: Adherent PBMC monolayer was washed twice with HBSS and monocytes were differentiated into hMDMs for 5 days in RPMI 1640 containing 100 ng/mL macrophage colony-stimulating factor (M-CSF, PeproTech) and 10% foetal calf serum ...
-
bioRxiv - Cell Biology 2020Quote: ... lines were maintained in StemFiT AK02 media (Ajinomoto) supplemented with 100 ng/ml recombinant human basic fibroblast growth factor (bFGF, Peprotech) (hereafter F/A media ...
-
bioRxiv - Immunology 2021Quote: The differentiation of isolated monocytes into macrophages was performed in RPMI 1640 GlutaMAx medium with 10% FCS and 1% P/S containing 100 ng/mL macrophage colony-stimulating factor (M-CSF) (PeproTech) for 7 days ...
-
bioRxiv - Developmental Biology 2020Quote: ... treated with 5 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 1 ...
-
bioRxiv - Microbiology 2020Quote: ... which was also combined with 100 or 500 ng/ml of the receptor activator of the NF-κB ligand (RANKL; Peprotech) application to the basolateral media where indicated.
-
bioRxiv - Immunology 2021Quote: ... macrophages were either maintained in an unactivated M0 state or they were M1-activated with 100 ng/mL of IFNg (Peprotech) and 100 ng/mL of LPS (MilliporeSigma ...
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Developmental Biology 2022Quote: ... #D1-011) according to manufacturer instructions by supplementing with 200 ng/ml human recombinant Sonic Hedgehog (Peprotech, Cat. #100-45) from day 0-10 and passaging cells at day 0 ...
-
bioRxiv - Immunology 2022Quote: ... bone marrow cells harvested from femurs and tibias of 6–10-week-old control or EROS-/- mice were grown in complete RPMI medium supplemented with 100 ng/mL of M-CSF (Peprotech) for 3 days ...