Labshake search
Citations for Peprotech :
1751 - 1800 of 5815 citations for Mono 2 Ethyl 5 Hydroxyhexyl Phthalate 13C4 99% Dehp Metabolite Ix 100 Ug Ml In Mtbe since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2023Quote: ... were incubated for 24 hours in RPMI-10 supplemented with IL-7 (5 ng/mL, Peprotech 217-17). T cells were then rinsed with PBS and 10 × 106 cells were resuspended in 20 µl of P4 primary cell nucleofection solution (P4 Primary Cell 4D-Nucleofector X Kit S ...
-
bioRxiv - Cell Biology 2020Quote: ... BMP-2 has a described solubility in aqueous solutions of 0.1 – 1 mg/mL (Peprotech, Hamburg, Germany), therefore allowing this multiplication.
-
bioRxiv - Cell Biology 2019Quote: ... and bone morphogenetic protein-2 (BMP2) 300 ng/ml (Peprotech, cat. # 120-02-2UG, Rocky Hill, NJ). The SSC used for differentiation experiments were no older than passage 3 in culture.
-
bioRxiv - Immunology 2022Quote: ... 20 ng/ml (20 units in 200 µl) recombinant murine IL-2 (PeproTECH cat#:212-12-100UG) was added to cultures when indicated ...
-
bioRxiv - Immunology 2022Quote: ... in 96 U-bottomed well plates and in the presence of IL-2 (50 ng/mL; Peprotech). 24h and 48h after stimulation ...
-
bioRxiv - Cancer Biology 2023Quote: ... viral supernatants were replaced with full RPMI-1640 medium supplemented with 200 U/ml IL-2 (PeproTech) and Dynabeads Human T-Activator CD3/CD28 (Thermo Fisher Scientific).
-
bioRxiv - Bioengineering 2024Quote: ... T-cell cultures were supplemented with 200 U/mL IL-2 (Cat # 200-02, Peprotech (Thermo Fisher), Cranbury ...
-
bioRxiv - Pathology 2023Quote: ... we used the established in vivo Treg induction cocktail consisting of recombinant murine IL2 (0.01 ug/gm, Peprotech, Catalog 212-12) complexed to anti-IL2 antibody (0.05 ug/gm ...
-
bioRxiv - Cell Biology 2021Quote: ... The cell pellet was resuspended in 0.5 mL pre-warmed ‘plating’ media supplemented with 100 ng/μL NGF (Peprotech). Cells from all spines were pooled before plating in microfluidic devices (MFDs ...
-
bioRxiv - Genetics 2022Quote: ... The medium was changed for complete growth medium containing TGF-β (10 ng/ml, Cat#100-21, PeproTech, USA) and IL-1β (1ng/ml ...
-
bioRxiv - Biochemistry 2021Quote: ... they were cultured in the presence of 0.5% FBS for the last 24 h and then incubated with 100-ng/ml human EGF (PeproTech) at 37°C for 5 min.
-
bioRxiv - Cell Biology 2022Quote: ... the aggregates were collected by gravitation and plated in N2B27 media supplemented with 100ng/ml VEGFA (Peprotech, 100-20) and 2 μM Forskolin (R&D system ...
-
bioRxiv - Neuroscience 2023Quote: ... and 100 ng/mL of CX3CL1 (Fractalkine/ chemokine (C-X3-C motif) ligand 1) (Peprotech, Catalog No. 300-31) for up to 12 days.
-
bioRxiv - Cell Biology 2022Quote: ... The cells were cultivated on 0.2 % gelatine-coated plates and were maintained in proliferation medium supplemented with 5 ng/ml bFGF (Peprotech) every second day (Rahman et al. ...
-
bioRxiv - Immunology 2023Quote: ... at a 1:1 bead:cell ratio in complete RPMI supplemented with 5 ng/mL IL-7 and IL-15 (both PeproTech) and after 48-72 h ...
-
bioRxiv - Immunology 2024Quote: ... stem cell factor (SCF; 5% supernatant of murine SCF-secreting CHO transfectants) and IL-4 (1 ng/ml, PeproTech) were added to the medium (89) ...
-
bioRxiv - Immunology 2019Quote: ... IL-2 (at a final concentration of 200 IU per ml and murine CXCL11 (Peprotech, Rocky Hill, NJ) at a final concentration of 2.7 mg/ml were added to the collagen mixture ...
-
bioRxiv - Immunology 2022Quote: ... cells were allowed to proliferate for two additional days by activation with 50 U/ml IL-2 (Peprotech) and 10% HS and 10% FBS ...
-
bioRxiv - Genetics 2021Quote: ... T cells were transferred to the culture medium supplemented with 30 IU/mL IL-2 (Peprotech, 200-02A). After electroporation for 3 days ...
-
bioRxiv - Immunology 2021Quote: ... diluted in complete RPMI (cRPMI; RPMI supplemented with 10% FBS plus recombinant human IL-2 (20IU/ml; Peprotech), as previously described.65,66 Activated cells were incubated for six days with a media change on day three.
-
bioRxiv - Immunology 2021Quote: ... in complete RMPI medium supplemented with the recombinant murine 1,000 U/ml IL-2 (PeproTech, Rocky Hill, NJ) and cultured for 5 days ...
-
bioRxiv - Immunology 2022Quote: ... and 2 mM glutamine (no BCS) with or without 10 ng/ml TGF-β1 (PeproTech, Rocky Hill, NJ). After 48 hours ...
-
bioRxiv - Cancer Biology 2019Quote: ... in 200µl of RPMI supplemented with 2% FBS and 5% Matrigel with or without the addition of human IFN-γ (PeproTech; #300-02), mouse IFN-γ (PeproTech ...
-
bioRxiv - Developmental Biology 2020Quote: ETV2-ECs and ETV2-SPI1-ECs were cultured on coverslips until day 12 of differentiation with VEGFA (50ng/ml) (cat. 100-20, Peprotech). BALB/c LSECs were cultured for 1.5-2 hours after isolation ...
-
bioRxiv - Immunology 2022Quote: ... we thawed cryopreserved TCRα/β-depleted BM fractions at 37°C and cultured them overnight in SFEM containing 100 ng/mL human stem cell factor (SCF, Peprotech), 100 ng/mL human Fms-related tyrosine kinase 3 (FLT3 ...
-
bioRxiv - Neuroscience 2020Quote: ... Medium was replaced on the next day by Neuronal Expansion-XF Medium supplemented with EGF (20 ng/ml; AF-100-15, Peprotech) and FGF (20 ng/ml ...
-
bioRxiv - Bioengineering 2021Quote: ... and vascular endothelial growth factor (VEGF) (Catalog No. 100-20, Recombinant Human VEGF165, Peprotech, Rocky Hill, NJ, 0.1 μg/mL). A mixture of heparin ...
-
bioRxiv - Bioengineering 2021Quote: Lyophilized 90 % PEGDMA microrods were loaded by resuspending ∼100,000 (100 k) microrod aliquots in 20 μL of 1 mg/mL recombinant human β-NGF (Peprotech) as described in the Protein loading of PEGDMA microrods section ...
-
bioRxiv - Biochemistry 2022Quote: ... HeLa cells at a plate confluence of 80% were treated for 10 min with 100 ng/mL animal-free recombinant human EGF (PeproTech) or Gibco™ distilled water (Thermo Fisher Scientific ...
-
bioRxiv - Molecular Biology 2022Quote: ... and cultured for 8 days in differentiation medium (DMEM F12, 10% KOSR, with 1% NEAA and 1% Glutamine) containing 100 ng/mL of HGF (Peprotech) and 1% DMSO (Sigma Aldrich) ...
-
bioRxiv - Neuroscience 2022Quote: ... in 100 μl embryoid body medium (10 mM ROCK inhibitor, 50 ng/mL BMP-4 (Peprotech; Cat. No. 120-05), 20 ng/mL SCF (Peprotech ...
-
The transcription factor RUNX2 drives the generation of human NK cells and promotes tissue residencybioRxiv - Immunology 2022Quote: After 48 hours of culture in preculture medium (complete IMDM medium supplemented with 10% FCS, stem cell factor (SCF) (100 ng/mL, Peprotech), FMS-like tyrosine kinase-3 ligand (FLT3-L ...
-
bioRxiv - Neuroscience 2020Quote: ... Expansion of the neural progenitor cells was carried out in Neural Expansion Media (NEM) which is composed of NBM supplemented with FGF (10ng/ml) (100-18C, Peprotech) and EGF (10ng/ml ...
-
bioRxiv - Microbiology 2020Quote: ... On DIV 10 add 100% N2 medium plus recombinant human Brain Derived Neurotrophic Factor 10ng/ml (BDNF 450-02; Peprotech); Glial-Derived Neurotrophic Factor 10ng/ml (GDNF 450-10 ...
-
bioRxiv - Cancer Biology 2019Quote: Transformation assay was performed by removing IL-3 through centrifugation and adding 50 ng/mL human HGF (Peprotech 100-39H). For proliferation assays cells were seeded in 96-well plates at 5,000 cells/well and the following day were exposed to crizotinib (Selleck Chemicals ...
-
bioRxiv - Cell Biology 2020Quote: ... lines were maintained in StemFiT AK02 media (Ajinomoto) supplemented with 100 ng/ml recombinant human basic fibroblast growth factor (bFGF, Peprotech) (hereafter F/A media ...
-
bioRxiv - Immunology 2021Quote: The differentiation of isolated monocytes into macrophages was performed in RPMI 1640 GlutaMAx medium with 10% FCS and 1% P/S containing 100 ng/mL macrophage colony-stimulating factor (M-CSF) (PeproTech) for 7 days ...
-
bioRxiv - Microbiology 2020Quote: ... which was also combined with 100 or 500 ng/ml of the receptor activator of the NF-κB ligand (RANKL; Peprotech) application to the basolateral media where indicated.
-
bioRxiv - Immunology 2021Quote: ... macrophages were either maintained in an unactivated M0 state or they were M1-activated with 100 ng/mL of IFNg (Peprotech) and 100 ng/mL of LPS (MilliporeSigma ...
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Developmental Biology 2022Quote: ... #D1-011) according to manufacturer instructions by supplementing with 200 ng/ml human recombinant Sonic Hedgehog (Peprotech, Cat. #100-45) from day 0-10 and passaging cells at day 0 ...
-
bioRxiv - Immunology 2022Quote: ... bone marrow cells harvested from femurs and tibias of 6–10-week-old control or EROS-/- mice were grown in complete RPMI medium supplemented with 100 ng/mL of M-CSF (Peprotech) for 3 days ...
-
bioRxiv - Developmental Biology 2022Quote: ... 150 μl of N2B27 medium supplemented with 100 ng/ml Activin A (QKine, Cambridge, UK) and 3 μM chiron (Peprotech) was added to each well ...
-
bioRxiv - Molecular Biology 2022Quote: ... Both SFEM II and our custom expansion media were supplemented with 100 ng/mL stem cell factor (Peprotech, 250-03), 40 ng/mL insulin-like growth factor (Peprotech ...
-
bioRxiv - Neuroscience 2023Quote: ... and plated onto 3 wells of a 6-well plate precoated with GFR Matrigel in N2B27 with 100ng/ml FGFb (100-18B, Peprotech) and 100ng/ml EGF (AF-100-15 ...
-
bioRxiv - Cell Biology 2023Quote: ... cells were either given fresh MC medium or cultured in basal MC medium (1% FBS) or in basal MC medium supplemented with 50ng/mL recombinant human VEGF-A165 (100-20; Peprotech) and culture for another 3 days.
-
bioRxiv - Immunology 2023Quote: ... HeLa-sia) at a ratio of 1:100 in complete RPMI medium supplemented with 10 ng/mL GM-CSF (PeproTech). Cancer cells were seeded at an initial concentration of 1×10e4 cells/mL and the same amount of medium supplemented with GM-CSF was added at day 4 of the experiment ...
-
bioRxiv - Genomics 2024Quote: ... Undifferentiated CD34+ cells were expanded for four days in prestimulation medium by adding 100 ng/ml stem cell factor (SCF; PeproTech), 100 ng/ml FLT3-ligand (PeproTech) ...