Labshake search
Citations for Peprotech :
1651 - 1700 of 2397 citations for Recombinant Human Low Density Lipoprotein Receptor Related Protein 1 since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Immunology 2022Quote: ... the cells were supplemented with murine rIFN-γ (40 μg/ml) (Recombinant Murine IFN-γ, Catalog Number:315-05, Peprotech) or were kept unaltered ...
-
bioRxiv - Immunology 2022Quote: ... The BM cells per animal were resuspended in growth medium and cultured at 1-2 x 106 cells/mL on sterile 6-well plates for 9 days in the presence of 200ng/ml recombinant murine Flt3-Ligand (Peprotech). The BM cells were maintained at 37°C in 5% CO2 ...
-
bioRxiv - Immunology 2019Quote: ... 50μM 2-ME and 100ng/ml recombinant murine macrophage colony stimulating factor (M-CSF, PeproTech Inc., Rocky Hill, NJ, USA) for 6 days ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Microbiology 2021Quote: ... cells were treated with recombinant mouse IFNβ (1000 U/ml, Stratech) or IL-10 (250 ng/ml, catalogue 210-10 Peprotech) 3 h prior to collection for immunoblotting.
-
bioRxiv - Immunology 2020Quote: ... approximately 2 x 106 cells were then seeded per 100 mm plate in 10 ml of media containing 20 ng/ml of recombinant murine (rm) GM-CSF (Peprotech). On day 3 ...
-
bioRxiv - Immunology 2021Quote: ... or medium alone for 6 h or with murine recombinant Interleukin–4 (rIL-4, 20 ng/mL, PeproTech EC Ltd.) for 24 h and analysed for MΦ activation markers by flow cytometry.
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Cell Biology 2021Quote: ... bone marrows were cultured and in vitro differentiated in bone marrow differentiation medium containing 40 ng/ml recombinant murine M-CSF (PeproTech) as described before (Sun et al. ...
-
bioRxiv - Immunology 2022Quote: Primary neuronal cells (DIV14) or oligodendrocytes were stimulated with 100 ng/μl of recombinant murine IL-12p70 (#210-12, Peprotech) for 5 min ...
-
bioRxiv - Immunology 2022Quote: ... primary neuronal cells were stimulated with 30 ng/μl or 100 ng/μl of Recombinant Murine IL-12p70 (#210-12, Peprotech) for 18 hours ...
-
bioRxiv - Immunology 2022Quote: ... or into bone marrow-derived dendritic cells (BMDC) in cRPMI supplemented with recombinant mouse IL-4 and GM-CSF (Peprotech). Influenza virus strains A/California/04/2009 (H1N1) ...
-
bioRxiv - Immunology 2022Quote: ... Bone marrow cells isolated from the bones of adult C57BL/6J mice were differentiated into bone marrow-derived macrophages (BMM) in cDMEM supplemented with recombinant mouse M-CSF (Peprotech) or into bone marrow-derived dendritic cells (BMDC ...
-
bioRxiv - Immunology 2022Quote: ... Th2 cells were generated by activating naïve CD4+ T cells with 1 μg/mL anti-CD3ε/3 μg/mL anti-CD28 for 3 days in complete T cell medium supplemented with 250U recombinant IL-4 (PeproTech), 6 μg/mL anti-IL-12 (BioXcell) ...
-
bioRxiv - Physiology 2024Quote: ... the digested cells were first incubated in RPMI 1640 with 10% FBS and 10 ng/ml recombinant murine IL-7 (PeproTech), and stimulated with 50 ng/ml phorbol 12-myristate 13-acetate ...
-
bioRxiv - Cell Biology 2024Quote: ... Recombinant basic fibroblasts growth factor (bFGF; 100-18B) and epidermal growth factor (EGF; AF-100-15) were purchased from PeproTech Inc..
-
bioRxiv - Immunology 2024Quote: ... The medium was also supplemented with 10 U/ml of DNaseI and 2 ng/mL of recombinant IL-15 (Peprotech). The cell suspension was transferred to a T25 flask (Corning ...
-
bioRxiv - Immunology 2024Quote: ... Approximately 5 × 106 NK cells were co-cultured with 1 × 107 of the modified and irradiated K562 feeder cells in 40 mL of Complete NK MACS medium supplemented with 100 U/mL of recombinant IL-2 (Peprotech) in a T75 flask (Corning) ...
-
bioRxiv - Immunology 2022Quote: ... splenocytes from control and Ncr1cre Mycfl/fl mice were left unstimulated or stimulated with 50 ng/mL recombinant mouse IL-15 (PeproTech) for 40 min at 37 °C and analyzed for intracellular protein phosphorylation by flow cytometry ...
-
bioRxiv - Pathology 2023Quote: ... Bone marrow was collected and cultured in RPMI-1640 complete medium (CM) containing 20ng/ml recombinant mouse GM-CSF (Peprotech). Subsequently ...
-
bioRxiv - Immunology 2023Quote: ... supplemented with 5% heat-inactivated fetal bovine serum (Biosera FB-1001) and 50ng/ml recombinant M-CSF (Peprotech 300-25). Differentiated macrophages were plated at a density of 1 x 106ml in the appropriate cell culture plate at least 1 d prior to stimulation.
-
bioRxiv - Neuroscience 2023Quote: ... Cells were replated onto glass coverslips at day 12 of the differentiation in N2/B27 medium supplemented with four recombinant growth factors at 25ng/ml (BDNF; ThermoFisher, NT3, NGF, GDNF; Peprotech). CHIR90221 was included for 4 further days ...
-
bioRxiv - Cancer Biology 2023Quote: ... Cells were passed through 70-micron cell strainer and subsequently cultured 10mL complete RPMI media supplemented with 20 ng/mL of recombinant murine M-CSF (576406; BioLegend, 315-02 PeproTech). On day 3 ...
-
bioRxiv - Immunology 2023Quote: ... Bone marrow-derived dendritic cells (BMDCs) were generated in tissue culture using recombinant GM-CSF (Peprotech, Cat. AF-315-03). Class B CpG 1826 oligonucleotide was synthesized by Integrated DNA Technologies ...
-
bioRxiv - Cancer Biology 2023Quote: ... Differentiation of BM cells into DCs was carried out in low attachment 10 mm cell culture dish in presence of bone marrow-differentiation media in presence of recombinant murine Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) (Cat. 315-03, Peprotech) for 48 a ...
-
bioRxiv - Cancer Biology 2023Quote: ... These tumoroids were then cultured in BEN selection media (basal medium with mouse recombinant EGF (50 ng/ml) and Noggin (100 ng/ml) (PeproTech) without R-spondin ...
-
bioRxiv - Neuroscience 2023Quote: ... Astrocytes were then cultured with and without 14 x 103 LNCs/well and treated with 10 ng/mL recombinant murine IFNγ (Peprotech), 100 nM PD-1/PD-L1 inhibitor (Thomas Scientific ...
-
bioRxiv - Immunology 2023Quote: ... Cultures were changed on day 4 to new complete RPMI 1640 medium containing recombinant murine IL-5 (10 ng/ml, Peprotech) and further fed with IL-5 every other day between days 10 to 14 ...
-
bioRxiv - Immunology 2024Quote: ... For Th1 polarization T lymphocytes were cultured with 5 ng/ml of recombinant murine IL-12 (Peprotech, catalog 210-12). For stimulation of preactivated T lymphocytes with type I IFN ...
-
bioRxiv - Immunology 2024Quote: ... Cells were plated in DMEM containing 10% v/v FBS and 10 ng/ml recombinant M-CSF (Peprotech #315-02). Cells were plated at a concentration of ∼150,000 cells per cm2 on non- treated Petri plates ...
-
bioRxiv - Immunology 2024Quote: ... Bone marrow was stimulated with recombinant murine IL-3 (10 ng/mL) and IL-6 (10 ng/mL) (Peprotech, 21616) for 48 hours ...
-
bioRxiv - Immunology 2024Quote: ... filtered and cultured for 7 days in complete RPMI medium (RPMI-1640 medium containing L-glutamine plus 10% fetal calf serum) containing 20ng/mL recombinant GM-CSF (Peprotech).
-
bioRxiv - Cancer Biology 2020Quote: ... human epidermal growth factor to 20ng/mL (PeproTech, Rocky Hill, NJ), cholera toxin to 100ng/mL (Thomas Scientific ...
-
bioRxiv - Cancer Biology 2019Quote: ... supplemented with human PDGF-AA (20 ng/mL; Peprotech 100-13A) or EGF (20 ng/mL ...
-
bioRxiv - Cancer Biology 2019Quote: ... supplemented with 100U/ml human IL-2 (Peprotech cat#200-02). IL-2 stock solution was made by reconstituting lyophilized cytokine to 10e6 U/ml in 50mM acetic acid ...
-
bioRxiv - Immunology 2021Quote: ... and human IL-2 (10 ng/ml; Peprotech, Rocky Hill, NJ) with or without splenic feeder cells depleted of B cells (50,000/well) ...
-
bioRxiv - Cancer Biology 2021Quote: ... and IFN-γ (PeproTech, human; 300-02 or mouse; 315-05) at 20 ng/ml and 10 ng/ml ...
-
bioRxiv - Bioengineering 2021Quote: ... in the presence of 200 IU/ml human IL-2 (PeproTech). We then stimulated T cells with Dynabeads™ Human T-Activator CD3/CD28 from ThermoFisher overnight with a ratio of beads to cells as 1:3 ...
-
bioRxiv - Bioengineering 2021Quote: ... The Human VEGF165 Standard ABTS ELISA Development Kit (900-K10; Peprotech) and ABTS ELISA Buffer Kit (900-K00 ...
-
bioRxiv - Neuroscience 2020Quote: ... and cells cultured in ND media supplemented with human BMP7 (PeproTech), human WNT3a (R&D Systems ...
-
bioRxiv - Developmental Biology 2022Quote: ... 10 ng/mL human FGF2 (PeproTech Inc., Rocky Hill, NJ, USA), 1 unit/mL heparin (Merck) ...
-
bioRxiv - Neuroscience 2022Quote: ... 50 ng/ml Human M-CSF (Peprotech; Cat. No. 300-25) and 50 ng/ml Human TGFB1 (Peprotech ...
-
bioRxiv - Neuroscience 2022Quote: ... and 50 ng/ml Human TGFB1 (Peprotech; Cat. No. 100-21C). On Day 8 ...
-
bioRxiv - Cancer Biology 2020Quote: ... 20 ng/ml human epidermal growth factor EGF (Peprotech, Hamburg, Germany), 10 ng/ml human basic fibroblast growth factor FGF (Peprotech) ...
-
bioRxiv - Physiology 2019Quote: ... and stimulated with 50 ng/ml human VEGF-A (Peprotech, Sweden) for 10 min at 37°C ...
-
bioRxiv - Neuroscience 2020Quote: Human IL-1β was purchased from PeproTech (Rocky Hills, NJ, USA) and Human and mouse Vegf-165 (VegfA ...
-
bioRxiv - Immunology 2020Quote: ... IL-7 and IL-33 (human and mouse) were from PeproTech. TLR4 agonist ...
-
bioRxiv - Neuroscience 2023Quote: ... 10 ng/ml human brain-derived neurotrophic factor (BDNF; PeproTech, UK) were added to the axonal compartment of MFCs to promote axonal growth ...