Labshake search
Citations for Peprotech :
1551 - 1600 of 1901 citations for Recombinant Human IL7 Protein since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Developmental Biology 2023Quote: ... and 0.1 μg/mL human R-Spondin-1 (Peprotech, USA). Alternatively ...
-
bioRxiv - Microbiology 2023Quote: ... 20 ng/ml human EGF (PeproTech, Cat# AF-100-15), and all-trans retinoic acid (ATRA ...
-
bioRxiv - Cancer Biology 2024Quote: ... 20⍰ng/ml human fibroblast growth factor (FGF)-10 (Peprotech), Noggin (Myltenyi) ...
-
bioRxiv - Neuroscience 2024Quote: ... 20 ng/ml human basic FGF-2 (#100-18B, PeproTech), and 1x PSF (#15240062 ...
-
bioRxiv - Neuroscience 2024Quote: ... 20 ng/ml human basic FGF-2 (#100-18B, PeproTech), 5 mg/ml Heparin (#H3149-50KU ...
-
bioRxiv - Neuroscience 2024Quote: ... 20 ng/ml human basic FGF-2 (#100-18B, PeproTech), 5mg/ml Heparin (#H3149-50KU ...
-
bioRxiv - Pharmacology and Toxicology 2024Quote: ... non-labelled murine and human chemokines were purchased from Peprotech. hCXCL8 ...
-
bioRxiv - Immunology 2019Quote: IL-2 complex (IL-2C) was prepared as described(79) by incubating 1 μg recombinant mouse IL-2 (PeproTech) with 5 μg purified anti-mouse IL-2 antibody (JES6-1 ...
-
bioRxiv - Immunology 2021Quote: ... Thawed stocks were plated in untreated Petri dishes with either GM-CSF or GM-CSF and TGFβ (20 ng/mL recombinant hTGFβ1 [Peprotech]) and sub-cultured as described above.
-
bioRxiv - Immunology 2021Quote: ... Two days later cells were passaged and cultured in fresh media supplemented with (12.5U/ml) recombinant IL-2 (PeproTech). Cells were passaged again after 24 hours ...
-
bioRxiv - Plant Biology 2019Quote: ... cells were stimulated with either 50 ng·ml−1 recombinant hVEGF-165 for 5 min (Peprotech, Rocky Hill, NJ, USA), 20 ng·ml−1 recombinant hPDGF-B for 5 min (Peprotech ...
-
bioRxiv - Neuroscience 2021Quote: ... and the pellet resuspended in 12 mL of DMEM media containing 10 ng/mL recombinant murine M-CSF (Peprotech). Cell suspensions were then pooled as required and placed in a 100 mm x 20 mm (diameter x height ...
-
bioRxiv - Immunology 2021Quote: ... (2) treated with recombinant mouse IL-12 (5 ng/ml) and IL-18 (25 ng/ml, both from Peprotech), (3 ...
-
bioRxiv - Immunology 2022Quote: ... heterologous Human naive T cells from healthy volunteers were sorted as CD3+CD4+CD45RA+CD45RO- and added to the culture at a ratio of 1:10 (DC:T cell) in the presence of IL-2 recombinant cytokine (50 ng/ml) (Peprotech). Five days post co-culture ...
-
bioRxiv - Cancer Biology 2024Quote: ... Growth factors were also given to media surrounding basement membrane extract (Cultrex, Biotechne): 1% Mouse recombinant Noggin (Peprotech, UK), 1% mouse recombinant EGF (Invitrogen ...
-
bioRxiv - Immunology 2024Quote: ... T cells were removed from stimulation and cultured in complete medium supplemented with10ng/ml recombinant mouse IL-7 (Peprotech) for 3-5 days as described (69).
-
bioRxiv - Immunology 2022Quote: ... or (15 ng/mouse) of recombinant-mouse IFN-γ (rIFN-γ expressed in E. coli; PeproTech, Rocky Hill, NJ), i.p ...
-
bioRxiv - Cancer Biology 2023Quote: ... Three weeks after transplantation mice were treated with 500 ng/mouse/day of recombinant IL1β (Peprotech, Cranbury, New Jersey) intraperitoneally ...
-
bioRxiv - Immunology 2022Quote: ... followed by addition of 100,000 sorted CD5- or CD71- DN3 thymocytes per well together with 10 ng/ml recombinant mouse IL-7 (PeproTech).
-
bioRxiv - Immunology 2023Quote: ... 6-week-old Foxp3IRES-GFP mice were injected intravenously with 10 μg of recombinant mouse IL2 (PeproTech, 212-12) or PBS vehicle control (in 110 μl volume) ...
-
bioRxiv - Neuroscience 2023Quote: ... Concentrations were centered in the nanomolar range previously used to study acute cytokine responses in neuron cultures.23,89 Recombinant murine cytokines were purchased from Peprotech, IFN-γ (cat 315-05) ...
-
bioRxiv - Molecular Biology 2023Quote: ... and resuspended in differentiation medium I-10 + M-CSF (i.e., IMDM, 10 % FBS, 1 mg/ml Pen/Strep containing 25 ng/ml recombinant murine M-CSF (PeproTech)) at a density of 1-2 Mio ...
-
bioRxiv - Cell Biology 2024Quote: ... Bone marrow-derived macrophages (BMDMs) were differentiated using 20 ng/ml of recombinant murine macrophage colony-stimulating factor (PeproTech) from bone marrow cells which were harvested from femurs and tibias ...
-
bioRxiv - Immunology 2021Quote: ... for 4 days at 37°C in complete RPMI medium supplemented with 10 ng/mL recombinant mouse IL-5 (PeproTech) and 20 ng/mL IL-2 (402-ML R&D) ...
-
bioRxiv - Immunology 2021Quote: ... for 4 days at 37°C in complete RPMI medium supplemented with 10 ng/mL recombinant mouse IL-5 (PeproTech) and 20 ng/mL IL-2 (402-ML R&D) ...
-
bioRxiv - Neuroscience 2021Quote: ... The cells were re-suspended in DMEM/F12 complete medium containing 20 ng/mL recombinant murine FGF (PeproTech, 450-33), 20 ng/mL recombinant murine EGF (PeproTech ...
-
bioRxiv - Immunology 2022Quote: Cells were cultured in complete T cell media supplemented with 5 ng/mL each of recombinant murine IL-7 and IL-15 (PeproTech). One day prior to activation of OT-I cells ...
-
bioRxiv - Neuroscience 2019Quote: ... or a combination of lipopolysaccharide (LPS, 100 ng/mL) and recombinant murine IFN□ (25 ng/mL, PeproTech, Rocky Hill, NJ). Concurrently ...
-
bioRxiv - Microbiology 2019Quote: ... and maintained as previously described[2] in media supplemented with 10ng/ml recombinant interleukin-4 and 10ng/ml granulocyte-macrophage colony stimulating factor (Peprotech). Bone marrow macrophages (BMMΦ ...
-
bioRxiv - Cancer Biology 2021Quote: ... Cells were allowed to attach on coverslip for 1 h and then cells were incubated with murine recombinant CCL2 (Peprotech) for 5 h ...
-
bioRxiv - Cancer Biology 2020Quote: ... Differentiation of BM cells into DCs was carried out in low attachment 10 mm cell culture dish in presence of bone marrow-differentiation media in presence of recombinant murine Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) (Cat. 315-03, Peprotech) for 48 h ...
-
bioRxiv - Cell Biology 2020Quote: ... Enteroendocrine cell reporter organoids were derived from the proximal small intestine of Neurog3-RFP mice (expressing RFP under the Neurog3 promoter) and cultured as described above using recombinant murine Noggin (100ng/ml, Peprotech) and 10% R-Spondin conditioned medium ...
-
bioRxiv - Cancer Biology 2022Quote: PDAC cells were seeded in a 6-well plate and after 24 hours were treated with 10 ng/ml of recombinant TGF-β1 (rTGF-β1, Peprotech) either alone or in the presence of 80 μM of Vactosertib (Vacto ...
-
bioRxiv - Immunology 2022Quote: ... 0.25 µg/mL Amphotericin B and 2 mM L-glutamine and treated with 10 ng/mL recombinant IL-12p70 (Peprotech) for 24 hours for supernatant IFN-γ analysis.
-
bioRxiv - Immunology 2022Quote: ... OT-I T cells were maintained inactivated in vitro (‘No TCR’ condition) with recombinant mouse IL-7 (Peprotech, 10ng/ml). For IL-2 replenishment experiments ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Immunology 2022Quote: ... the cells were supplemented with murine rIFN-γ (40 μg/ml) (Recombinant Murine IFN-γ, Catalog Number:315-05, Peprotech) or were kept unaltered ...
-
bioRxiv - Immunology 2022Quote: ... The BM cells per animal were resuspended in growth medium and cultured at 1-2 x 106 cells/mL on sterile 6-well plates for 9 days in the presence of 200ng/ml recombinant murine Flt3-Ligand (Peprotech). The BM cells were maintained at 37°C in 5% CO2 ...
-
bioRxiv - Immunology 2019Quote: ... 50μM 2-ME and 100ng/ml recombinant murine macrophage colony stimulating factor (M-CSF, PeproTech Inc., Rocky Hill, NJ, USA) for 6 days ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
The skin environment controls local dendritic cell differentiation and function through innate IL-13bioRxiv - Immunology 2021Quote: ... were harvested and one million cells were resuspended in 1 mL of TCM in 24 wells plates and stimulated with recombinant mouse IL-13 (Peprotech) at a concentration of 100 ng/mL for 30 min at 37°C ...
-
bioRxiv - Microbiology 2021Quote: ... cells were treated with recombinant mouse IFNβ (1000 U/ml, Stratech) or IL-10 (250 ng/ml, catalogue 210-10 Peprotech) 3 h prior to collection for immunoblotting.
-
bioRxiv - Immunology 2020Quote: ... approximately 2 x 106 cells were then seeded per 100 mm plate in 10 ml of media containing 20 ng/ml of recombinant murine (rm) GM-CSF (Peprotech). On day 3 ...
-
bioRxiv - Immunology 2021Quote: ... or medium alone for 6 h or with murine recombinant Interleukin–4 (rIL-4, 20 ng/mL, PeproTech EC Ltd.) for 24 h and analysed for MΦ activation markers by flow cytometry.
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Cell Biology 2021Quote: ... bone marrows were cultured and in vitro differentiated in bone marrow differentiation medium containing 40 ng/ml recombinant murine M-CSF (PeproTech) as described before (Sun et al. ...
-
bioRxiv - Immunology 2022Quote: Primary neuronal cells (DIV14) or oligodendrocytes were stimulated with 100 ng/μl of recombinant murine IL-12p70 (#210-12, Peprotech) for 5 min ...
-
bioRxiv - Immunology 2022Quote: ... primary neuronal cells were stimulated with 30 ng/μl or 100 ng/μl of Recombinant Murine IL-12p70 (#210-12, Peprotech) for 18 hours ...
-
bioRxiv - Immunology 2022Quote: ... or into bone marrow-derived dendritic cells (BMDC) in cRPMI supplemented with recombinant mouse IL-4 and GM-CSF (Peprotech). Influenza virus strains A/California/04/2009 (H1N1) ...