Labshake search
Citations for Peprotech :
1501 - 1550 of 2239 citations for IL 23R Human HEK293 Fc since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2022Quote: ... cells were treated for 48h with IL-4 (10 ng/mL; Peprotech, Rocky Hill, NJ, USA) to increase TMEM16A expression.
-
bioRxiv - Immunology 2022Quote: ... These cells were cultured for 3 days in media containing 20 ng/ml IL-12 (Peprotech), 50 ng/ml IL-2 ...
-
bioRxiv - Neuroscience 2023Quote: ... Microglia media is supplemented with fresh cytokines before each use: 100 ng/mL IL-34 (Peprotech), 50 ng/mL TGFβ1 (Millitenyi Biotech) ...
-
bioRxiv - Immunology 2023Quote: ... For B cell cultures, CD40L-trimer (2 nM, EnzoLifeScience) and IL-21 (100 ng/mL, Peprotech) were added ...
-
bioRxiv - Immunology 2022Quote: ... Complexes were prepared by mixing recombinant mouse IL-2 (Cat# 212-12, 100 μg/ml; Peprotech) with anti-IL-2 mAb at a molar ratio of 2:1 in PBS ...
-
bioRxiv - Immunology 2023Quote: ... the following agents were administered via intraperitoneal injection: recombinant mouse IL-15 (2.5 μg/dose; PeproTech), anti-mouse IL-15 antibody (25 μg/dose ...
-
bioRxiv - Immunology 2023Quote: Recombinant mouse TNF (Cat#315-01A) and IL-3 (Cat#213-13) were purchased from Peprotech. FBS (Cat# SH30396 ...
-
bioRxiv - Bioengineering 2023Quote: ... and cultured in RPMI-1640 supplemented with 100U/ml IL-2 (PeproTech, Rocky Hill, NJ, USA), 10% FBS and 1x penicillin/streptomycin for 3 days at 37°C under a humidified atmosphere with 5% CO2 incubator to obtain T cell blasts ...
-
bioRxiv - Immunology 2023Quote: ... Purified NK cells were cultured in complete RPMI supplemented with 100 U/mL IL-2 (Peprotech) overnight and labelled with CellTrace Yellow (ThermoFisher ...
-
bioRxiv - Immunology 2023Quote: ... Supernatants were harvested and used in triplicate to quantitate IL-1β using ELISA kit from PeproTech.
-
bioRxiv - Immunology 2024Quote: Recombinant mouse TNF (Cat# 315-01A) and IL-3 (Cat# 213-13) were procured from Peprotech. The mouse monoclonal antibody to mouse TNF (MAb ...
-
bioRxiv - Cancer Biology 2024Quote: ... CD8+ TILs were cultured in ImmunoCult (STEMCELL, 10981) + 50 ng/mL IL-2 (PeproTech, 200-02). Jurkat and patient derived tumour cell lines 10101 and 10164 were cultured in RPMI (Corning ...
-
bioRxiv - Biophysics 2021Quote: ... the medium was replaced by RPMI containing 10% FCS and 20 ng/mL of Macrophage Colony-Stimulating Factor (M-CSF) (Peprotech). For experiments ...
-
bioRxiv - Cell Biology 2021Quote: ... the remaining one-third of the chamber was filled with complete RPMI 1640 supplemented with 10% FCS in the presence or absence of 0.6 μg/ml murine CCL19 (Peprotech, USA). The slowly diffusing CCL19-containing medium creates a CCL19 gradient that promotes BMDC migration towards the upper part of the chamber.
-
The transcription factor RUNX2 drives the generation of human NK cells and promotes tissue residencybioRxiv - Immunology 2022Quote: After 48 hours of culture in preculture medium (complete IMDM medium supplemented with 10% FCS, stem cell factor (SCF) (100 ng/mL, Peprotech), FMS-like tyrosine kinase-3 ligand (FLT3-L ...
-
bioRxiv - Immunology 2020Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Immunology 2022Quote: ... 100 U ml−1 penicillin-streptomycin and 10% FCS) with 20 ng ml−1 murine macrophage colony-stimulating factor 1 (CSF-1; Peprotech) for 7 days ...
-
bioRxiv - Immunology 2020Quote: ... cells were seeded in complete DMEM medium (10% FCS, 1000 U/ml Penicillin, 100 µg/ml Streptomycin) containing 30 ng/mL of mouse M-CSF (Peprotech). After two successive medium replacement (at D3 and D6) ...
-
bioRxiv - Immunology 2021Quote: The differentiation of isolated monocytes into macrophages was performed in RPMI 1640 GlutaMAx medium with 10% FCS and 1% P/S containing 100 ng/mL macrophage colony-stimulating factor (M-CSF) (PeproTech) for 7 days ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2023Quote: ... mouse bone marrow was flushed and cultured for 2 days in stem cell medium (DMEM + 15% FCS + 25ng/ml SCF (PeproTech) + 10ng/ml IL-3 (PeproTech ...
-
bioRxiv - Cancer Biology 2021Quote: ... and supplemented with murine SCF (10 ng/ml) and IL-3 (10 ng/ml) (Peprotech or BioLegend). The cells were serially passaged for ∼1 month ...
-
bioRxiv - Cell Biology 2022Quote: ... sorted CD31-Rspo3+ cells were cultured and recombinant murine IL-1a (10 ng/ml, Peprotech, 211-11A) was administered to each well 24 hours prior to RNA extraction.
-
bioRxiv - Bioengineering 2020Quote: ... BCi-NS1.1 cultures were maintained in medium with IL-13 (100 ng/mL, Peprotech, Rocky Hill, NJ) for 7 days prior to en face staining and MCC experiments.
-
bioRxiv - Cancer Biology 2022Quote: ... Cells were initially cultured in IMDM +20 % FBS (AtlantaBiologics) in recombinant murine IL-3 and SCF (Peprotech), both at 50 ng/mL ...
-
bioRxiv - Immunology 2022Quote: ... and gentamycin supplemented with Flt3 (5 ng/ml; R&D) and IL-7 (1 ng/ml; Peprotech). For the scRNA-seq experiments ...
-
bioRxiv - Immunology 2020Quote: ... then resuspended at 2 x 105 cells/mL in media supplemented with 20ng/mL IL-2 (PeproTech). miRNA inhibitors (miRCURY LNA miRNA power inhibitor with or without 5’-FAM ...
-
bioRxiv - Immunology 2020Quote: ... IL-6 and stem cell factor (at concentrations of 20, 50 and 100 ng/mL, respectively; Peprotech). Cells were ‘spin-infected’ twice at days 1 and 2 and then transferred into irradiated recipients.
-
bioRxiv - Immunology 2020Quote: ... Th1 polarization was achieved by supplying cultures with 10 ng/ml IL-12 (PeproTech, Rocky Hill, NJ) and 10 μg/ml anti–IL-4 (Biolegend ...
-
bioRxiv - Immunology 2022Quote: ... the cells were resuspended in pre-warmed (37°C) recombinant IL-12-containing (20 ng/ml; PeproTech) medium for 15 min to induce phosphorylation of STAT4 ...
-
bioRxiv - Cancer Biology 2022Quote: ... Non-enriched cells were cultured and expanded in TCM supplemented with 5 ng/mL IL-7 (Peprotech) and 5 ng/mL IL-15 (Peprotech ...
-
bioRxiv - Immunology 2022Quote: ... or (3) 10 μg/ml LPS and 10 ng/ml mouse IL-4 (PeproTech Inc, 214-14).
-
bioRxiv - Immunology 2022Quote: ... 20 ng/ml (20 units in 200 µl) recombinant murine IL-2 (PeproTECH cat#:212-12-100UG) was added to cultures when indicated ...
-
bioRxiv - Immunology 2022Quote: ... in 96 U-bottomed well plates and in the presence of IL-2 (50 ng/mL; Peprotech). 24h and 48h after stimulation ...
-
bioRxiv - Immunology 2023Quote: ... The following conditions were used for Th2 cell differentiation: IL-4 (25 ng/ml, Peprotech, 214-14), IL-2 (10 U/ml ...
-
ALS iPSC-derived microglia and motor neurons respond to astrocyte-targeted IL-10 and CCL2 modulationbioRxiv - Neuroscience 2023Quote: Treatments of SOD1 and C9ORF72 astrocytes were performed with 430pg/mL recombinant IL-10 (PeproTech, #200-10) and 2ng/mL CCL2 neutralizing antibodies (Bio-Techne ...
-
bioRxiv - Bioengineering 2023Quote: ... M2-like macrophages were activated by adding 25ng/mL interleukin 4 (IL-4; PeproTech: 200-04-50UG) and 25ng/mL IL-13 (PeproTech ...
-
bioRxiv - Immunology 2023Quote: ... 10 ng/ml recombinant stem cell factor (SCF) and 10 ng/ml IL-3 (both from Peprotech). Femur and tibia bone marrows from one mouse were initially seeded in 10 ml medium in a 25 cm2 tissue culture flask (Corning ...
-
bioRxiv - Immunology 2023Quote: ... BMMCs in culture media were also stimulated with LPS (#3024, Wako) or IL-33 (#210-33, Peprotech).
-
bioRxiv - Immunology 2023Quote: ... M-CSF (50 ng/ml) or GM-CSF+IL-4 (50 ng/ml; PeproTech, Rocky Hill, NJ). Cells were harvested at various time points for flow cytometric analysis or RNA isolation.
-
bioRxiv - Cancer Biology 2023Quote: ... viral supernatants were replaced with full RPMI-1640 medium supplemented with 200 U/ml IL-2 (PeproTech) and Dynabeads Human T-Activator CD3/CD28 (Thermo Fisher Scientific).
-
bioRxiv - Bioengineering 2024Quote: ... T-cell cultures were supplemented with 200 U/mL IL-2 (Cat # 200-02, Peprotech (Thermo Fisher), Cranbury ...
-
bioRxiv - Cancer Biology 2021Quote: ... 20 ng/ml recombinant human GRO-α/MGSA (CXCL1; Peprotech), and 25 ng/ml recombinant human HGF (Peprotech) ...
-
bioRxiv - Cancer Biology 2021Quote: ... 20ng/ml Human FGF rec 154aa (Peprotech, GMP100-18 B), 10 ng/ml EGF (Sigma ...
-
bioRxiv - Cell Biology 2020Quote: ... 10 ng/mL recombinant human LIF (hLIF; Peprotech 300-05); 3 µM CHIR99021 (Tocris 4423) ...
-
bioRxiv - Cell Biology 2020Quote: Human recombinant TNF-α and RANK-L were from PeproTech. Mouse monoclonal antibody to glycoprotein-2 (Gp-2 ...
-
bioRxiv - Cell Biology 2020Quote: ... Human TGF-β was purchased from Peprotech (Rocky Hill, NJ). Cycloheximide ...
-
bioRxiv - Molecular Biology 2020Quote: ... human EGF 20 ng/mL (PeproTech, Rocky Hill, NJ, USA), tocopherol ...