Labshake search
Citations for Peprotech :
1351 - 1400 of 1890 citations for Polybrominated Diphenyl Ether Predominant Congener Mixture 1 100 Dilution Unlabeled since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Immunology 2022Quote: ... we thawed cryopreserved TCRα/β-depleted BM fractions at 37°C and cultured them overnight in SFEM containing 100 ng/mL human stem cell factor (SCF, Peprotech), 100 ng/mL human Fms-related tyrosine kinase 3 (FLT3 ...
-
bioRxiv - Molecular Biology 2019Quote: ... MLO-Y4 cells were treated with the following reagents in serum-free media: 5 ng/ml TGFβ1 (Peprotech, 100-36E), 0.1 μM PGE2 (Sigma) ...
-
bioRxiv - Neuroscience 2019Quote: ... or a combination of lipopolysaccharide (LPS, 100 ng/mL) and recombinant murine IFN□ (25 ng/mL, PeproTech, Rocky Hill, NJ). Concurrently ...
-
bioRxiv - Neuroscience 2020Quote: ... Medium was replaced on the next day by Neuronal Expansion-XF Medium supplemented with EGF (20 ng/ml; AF-100-15, Peprotech) and FGF (20 ng/ml ...
-
bioRxiv - Neuroscience 2021Quote: ... in the presence of 30 ng/mL M-CSF and 100 ng/mL receptor activator of nuclear factor kappa-B ligand (RANKL, PeproTech) (Sousa et al. ...
-
bioRxiv - Bioengineering 2020Quote: ... the iPSCs were first cultured in basal medium (RPMI-1640 with 2% B27) supplemented with 100 ng/ml Activin A (Peprotech) and 3 μM CHIR99021 for 3 days and then with 5 ng/ml bFGF ...
-
bioRxiv - Bioengineering 2021Quote: ... and vascular endothelial growth factor (VEGF) (Catalog No. 100-20, Recombinant Human VEGF165, Peprotech, Rocky Hill, NJ, 0.1 μg/mL). A mixture of heparin ...
-
bioRxiv - Cell Biology 2021Quote: ... 100 U/ml penicillin and 100 µg/ml streptomycin sulfate (Nacalai Tesque) and 4 ng/ml basic fibroblast growth factor (Peprotech).
-
bioRxiv - Biochemistry 2022Quote: ... HeLa cells at a plate confluence of 80% were treated for 10 min with 100 ng/mL animal-free recombinant human EGF (PeproTech) or Gibco™ distilled water (Thermo Fisher Scientific ...
-
bioRxiv - Molecular Biology 2022Quote: ... The isolated cells were cultured in RPMI medium supplemented with 20% (v/v) FBS and 100 ng/mL human recombinant IL-2 (Peprotech). Two days prior to transduction ...
-
bioRxiv - Neuroscience 2022Quote: ... in 100 μl embryoid body medium (10 mM ROCK inhibitor, 50 ng/mL BMP-4 (Peprotech; Cat. No. 120-05), 20 ng/mL SCF (Peprotech ...
-
bioRxiv - Immunology 2022Quote: ... cells were maintained in 24-well G-Rex plates (Wilson Wolf) in NK MACS media (Miltenyi Biotech) supplemented with human IL-2 (100 IU/mL, Peprotech) and human IL-15 (20 ng/mL ...
-
The transcription factor RUNX2 drives the generation of human NK cells and promotes tissue residencybioRxiv - Immunology 2022Quote: After 48 hours of culture in preculture medium (complete IMDM medium supplemented with 10% FCS, stem cell factor (SCF) (100 ng/mL, Peprotech), FMS-like tyrosine kinase-3 ligand (FLT3-L ...
-
bioRxiv - Neuroscience 2020Quote: ... Expansion of the neural progenitor cells was carried out in Neural Expansion Media (NEM) which is composed of NBM supplemented with FGF (10ng/ml) (100-18C, Peprotech) and EGF (10ng/ml ...
-
bioRxiv - Developmental Biology 2019Quote: ... Growth factors were added at a final concentration of : 50 ng/ml EGF and 100 ng/ml Noggin (both from Peprotech), and 100 ng/ml CHO-derived mouse R-spondin 1 or 5 ng/ml CHO-derived mouse R-spondin 2 (R&D System) ...
-
bioRxiv - Microbiology 2020Quote: ... On DIV 10 add 100% N2 medium plus recombinant human Brain Derived Neurotrophic Factor 10ng/ml (BDNF 450-02; Peprotech); Glial-Derived Neurotrophic Factor 10ng/ml (GDNF 450-10 ...
-
bioRxiv - Cancer Biology 2021Quote: ... and then cultured in CTS T Cell Expansion medium (Thermo) containing 10% FBS and 100 IU/ml human IL-2 (PeproTech). The CellTiter 96 MTS assay (Promega ...
-
bioRxiv - Immunology 2020Quote: ... cells were seeded in complete DMEM medium (10% FCS, 1000 U/ml Penicillin, 100 µg/ml Streptomycin) containing 30 ng/mL of mouse M-CSF (Peprotech). After two successive medium replacement (at D3 and D6) ...
-
bioRxiv - Cancer Biology 2019Quote: Transformation assay was performed by removing IL-3 through centrifugation and adding 50 ng/mL human HGF (Peprotech 100-39H). For proliferation assays cells were seeded in 96-well plates at 5,000 cells/well and the following day were exposed to crizotinib (Selleck Chemicals ...
-
bioRxiv - Immunology 2021Quote: ... supplemented with 1% penicillin/streptomycin (P/S) and 20 ng/ml recombinant mouse GM-CSF or 100 ng/ml recombinant mouse M-CSF (PeproTech). For the M-CSF-supplemented cultures ...
-
bioRxiv - Immunology 2020Quote: Adherent PBMC monolayer was washed twice with HBSS and monocytes were differentiated into hMDMs for 5 days in RPMI 1640 containing 100 ng/mL macrophage colony-stimulating factor (M-CSF, PeproTech) and 10% foetal calf serum ...
-
bioRxiv - Cell Biology 2020Quote: ... Adherent cells were then detached with a cell scrapper and seeded at a density of 5 × 104 cells/cm2 in the presence of 30 ng/mL M-CSF and 100 ng/mL receptor activator of nuclear factor kappa-B ligand (RANKL, PeproTech) (Bartell et al. ...
-
bioRxiv - Cell Biology 2020Quote: ... lines were maintained in StemFiT AK02 media (Ajinomoto) supplemented with 100 ng/ml recombinant human basic fibroblast growth factor (bFGF, Peprotech) (hereafter F/A media ...
-
bioRxiv - Cancer Biology 2020Quote: ... 100 ng/mL fms-like tyrosine kinase 3 ligand (Flt-3L) and 50 ng/mL thrombopoietin (TPO) (all from Peprotech). ES and IPS derived EB were cultured in ultra low attachment 6-well plates (Costar ...
-
bioRxiv - Developmental Biology 2020Quote: ... treated with 5 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 1 ...
-
bioRxiv - Microbiology 2020Quote: ... which was also combined with 100 or 500 ng/ml of the receptor activator of the NF-κB ligand (RANKL; Peprotech) application to the basolateral media where indicated.
-
bioRxiv - Immunology 2021Quote: ... macrophages were either maintained in an unactivated M0 state or they were M1-activated with 100 ng/mL of IFNg (Peprotech) and 100 ng/mL of LPS (MilliporeSigma ...
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Immunology 2021Quote: ... Forty-eight hours later cells were lifted off the plates and cultures were supplemented with 100 U/ml recombinant human IL-2 (Peprotech). CFSE labeling for certain experiments was performed prior to seeding on tissue culture plates.
-
Neutralizing activity of broadly neutralizing anti-HIV-1 antibodies against primary African isolatesbioRxiv - Immunology 2020Quote: ... A total of 2×106 CD4+ T lymphocytes were activated using anti CD3/CD2/CD28 beads (Miltenyi) and cultured in the presence of 100 U/mL IL-2 (Peprotech) at 37 °C and 5% CO2 ...
-
bioRxiv - Immunology 2020Quote: ... approximately 2 x 106 cells were then seeded per 100 mm plate in 10 ml of media containing 20 ng/ml of recombinant murine (rm) GM-CSF (Peprotech). On day 3 ...
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Developmental Biology 2022Quote: ... #D1-011) according to manufacturer instructions by supplementing with 200 ng/ml human recombinant Sonic Hedgehog (Peprotech, Cat. #100-45) from day 0-10 and passaging cells at day 0 ...
-
bioRxiv - Immunology 2022Quote: Primary neuronal cells (DIV14) or oligodendrocytes were stimulated with 100 ng/μl of recombinant murine IL-12p70 (#210-12, Peprotech) for 5 min ...
-
bioRxiv - Immunology 2022Quote: ... primary neuronal cells were stimulated with 30 ng/μl or 100 ng/μl of Recombinant Murine IL-12p70 (#210-12, Peprotech) for 18 hours ...
-
bioRxiv - Cell Biology 2022Quote: ... 1.5 x 105 cells were seeded on collagen-coated 60 mm dishes and treated daily with 200 pM TGF-β1 (100-21; PeproTech) dissolved in DMEM media with 1% BSA and 1% penicillin/streptomycin for 4 days ...
-
bioRxiv - Immunology 2022Quote: ... bone marrow cells harvested from femurs and tibias of 6–10-week-old control or EROS-/- mice were grown in complete RPMI medium supplemented with 100 ng/mL of M-CSF (Peprotech) for 3 days ...
-
bioRxiv - Cancer Biology 2022Quote: ... 100 ng/mL fms-like tyrosine kinase 3 ligand (Flt-3L) and 50 ng/mL thrombopoietin (TPO) (all from Peprotech). ES and IPS derived EB were cultured in ultra-low attachment 6-well plates (Costar ...
-
bioRxiv - Developmental Biology 2022Quote: ... 150 μl of N2B27 medium supplemented with 100 ng/ml Activin A (QKine, Cambridge, UK) and 3 μM chiron (Peprotech) was added to each well ...
-
bioRxiv - Molecular Biology 2022Quote: ... Both SFEM II and our custom expansion media were supplemented with 100 ng/mL stem cell factor (Peprotech, 250-03), 40 ng/mL insulin-like growth factor (Peprotech ...
-
bioRxiv - Immunology 2023Quote: ... Isolated T cells were otherwise activated using plate bound anti-CD3 (5 μg/ml, inVIVOMAb Cat# BE0002) in complete medium added with 100 U/ml IL-2 (Peprotech) and soluble αCD28 (0.5 μg/ml ...
-
bioRxiv - Cancer Biology 2023Quote: ... and conditioned media containing approximately 100 ng/ml SCF for the generation of neutrophil-biased cells or GM-CSF 10 ng/ml (Peprotech) for the generation of macrophage progenitors ...
-
bioRxiv - Bioengineering 2023Quote: ... After gelation samples were submerged in IMR90 medium with/without 2 ng/mL TGF-β2 (100-35B; PeproTech, Cranbury, NJ). Cultures were monitored for loss of collagen adhesion and contraction of the gel for 21 d and survival was quantified as described above.
-
bioRxiv - Neuroscience 2023Quote: ... and plated onto 3 wells of a 6-well plate precoated with GFR Matrigel in N2B27 with 100ng/ml FGFb (100-18B, Peprotech) and 100ng/ml EGF (AF-100-15 ...
-
bioRxiv - Immunology 2023Quote: ... The cells were washed and replated in complete RPMI 1640 medium with 100 U/ml IL-2 (PeproTech, 200-02) 48 hours later ...
-
bioRxiv - Cancer Biology 2023Quote: ... These tumoroids were then cultured in BEN selection media (basal medium with mouse recombinant EGF (50 ng/ml) and Noggin (100 ng/ml) (PeproTech) without R-spondin ...
-
bioRxiv - Developmental Biology 2023Quote: ... and supplemented with 10 ng/ml recombinant Activin A (STEMCELLTM 78001) and 10 ng/ml recombinant FGF2 (Peprotech 100-18B). ReproFF2 or StemFit media resulted in comparable gene induction (data on request) ...
-
bioRxiv - Cell Biology 2023Quote: ... glutamine and human early-acting cytokines (SCF 300 ng/ml, Flt3-L 300 ng/ml, TPO 100 ng/ml, and IL-3 60 ng/ml; all purchased from Peprotech). All cultures were kept at 37°C in a 5% CO2 water jacket incubator (Thermo Scientific ...
-
bioRxiv - Cancer Biology 2024Quote: ... according to manufacturer’s specifications in the presence of 100 IU/mL recombinant human (rh) IL-2 and 10 ng/mL rhIL-7 (Peprotech). Spinoculation with neat 293 Galv9 retroviral supernatant was performed at 48 ...