Labshake search
Citations for Peprotech :
1251 - 1300 of 1515 citations for Recombinant Mouse CD33 Protein since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cancer Biology 2021Quote: ... supplemented only with 100 ng/ml recombinant human stem cell factor (rhSCF, Milteny Biotech) and 30 ng/ml recombinant human interleukin 3 (rh IL-3, both Peprotech).
-
bioRxiv - Molecular Biology 2021Quote: ... 2-day cultured activated cells were washed and then cultured for 2 days in culture media supplemented with 20ng/mL recombinant human IL-2 (PeproTech) in the presence or absence of 10μM GC7 (Merck Chemicals) ...
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Immunology 2021Quote: ... Forty-eight hours later cells were lifted off the plates and cultures were supplemented with 100 U/ml recombinant human IL-2 (Peprotech). CFSE labeling for certain experiments was performed prior to seeding on tissue culture plates.
-
bioRxiv - Immunology 2020Quote: ... approximately 2 x 106 cells were then seeded per 100 mm plate in 10 ml of media containing 20 ng/ml of recombinant murine (rm) GM-CSF (Peprotech). On day 3 ...
-
bioRxiv - Immunology 2021Quote: ... or medium alone for 6 h or with murine recombinant Interleukin–4 (rIL-4, 20 ng/mL, PeproTech EC Ltd.) for 24 h and analysed for MΦ activation markers by flow cytometry.
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Cell Biology 2021Quote: ... bone marrows were cultured and in vitro differentiated in bone marrow differentiation medium containing 40 ng/ml recombinant murine M-CSF (PeproTech) as described before (Sun et al. ...
-
bioRxiv - Microbiology 2021Quote: ... the viral suspension was removed and replaced via 100 μL of NDM or NDM supplemented with 100 ng/mL of recombinant human IL-1β (200-01B, Peprotech), IL-6 (200-06 ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Developmental Biology 2022Quote: ... #D1-011) according to manufacturer instructions by supplementing with 200 ng/ml human recombinant Sonic Hedgehog (Peprotech, Cat. #100-45) from day 0-10 and passaging cells at day 0 ...
-
bioRxiv - Immunology 2022Quote: Primary neuronal cells (DIV14) or oligodendrocytes were stimulated with 100 ng/μl of recombinant murine IL-12p70 (#210-12, Peprotech) for 5 min ...
-
bioRxiv - Immunology 2022Quote: ... primary neuronal cells were stimulated with 30 ng/μl or 100 ng/μl of Recombinant Murine IL-12p70 (#210-12, Peprotech) for 18 hours ...
-
bioRxiv - Bioengineering 2022Quote: ... the spheroids were then transferred to spinal cord medium II (ScM II) with 10 nM retinoic acid and 5 ng/mL recombinant human BMP4 (Peprotech) for the next 6 days ...
-
bioRxiv - Neuroscience 2023Quote: ... iSNs were treated with 10% plasma or 100ng/mL recombinant human ET1 (R&D, #1160) or CCL2 (PeproTech, #300-04) diluted in iSN maturation media for 30 minutes at 37°C ...
-
bioRxiv - Immunology 2022Quote: ... Th2 cells were generated by activating naïve CD4+ T cells with 1 μg/mL anti-CD3ε/3 μg/mL anti-CD28 for 3 days in complete T cell medium supplemented with 250U recombinant IL-4 (PeproTech), 6 μg/mL anti-IL-12 (BioXcell) ...
-
bioRxiv - Physiology 2024Quote: ... the digested cells were first incubated in RPMI 1640 with 10% FBS and 10 ng/ml recombinant murine IL-7 (PeproTech), and stimulated with 50 ng/ml phorbol 12-myristate 13-acetate ...
-
bioRxiv - Cancer Biology 2024Quote: ... at 3:1 bead: T-cell ratio together with human recombinant IL-15 and IL-7 (PeproTech; 5 ng/mL) in AIM-V medium supplemented with 5% FBS ...
-
bioRxiv - Cancer Biology 2024Quote: ... according to manufacturer’s specifications in the presence of 100 IU/mL recombinant human (rh) IL-2 and 10 ng/mL rhIL-7 (Peprotech). Spinoculation with neat 293 Galv9 retroviral supernatant was performed at 48 ...
-
bioRxiv - Immunology 2024Quote: ... Cells were expanded for at least 1 week in the presence of IL-3 and 30 ng/mL recombinant SCF (Peprotech) to obtain peritoneal cavity-derived mast cells (PCMCs) ...
-
bioRxiv - Cell Biology 2024Quote: ... Recombinant basic fibroblasts growth factor (bFGF; 100-18B) and epidermal growth factor (EGF; AF-100-15) were purchased from PeproTech Inc..
-
bioRxiv - Immunology 2024Quote: ... splenocytes were restimulated for 5 hours at 37°C with 1 μg/ml of MHC class I-restricted LCMV peptide gp33-41 in the presence of 2 ng/ml recombinant human IL-2 (Peprotech), 10% fetal bovine serum (premium FBS ...
-
bioRxiv - Developmental Biology 2024Quote: ... expanded neural progenitors were re-plated at a density of 3×104 cells/cm2 in expansion media and 24 hours later switched to N2B27 supplemented with 10 ng/mL human recombinant CNTF (Peprotech) and 10 ng/mL human recombinant BMP4 (Peprotech ...
-
bioRxiv - Genomics 2024Quote: ... macrophages were cultured in macrophage media supplemented with 20 ng/ml human recombinant IFN-γ (PeproTech, catalog no. 300-02) and 25 ng/ml LPS (Invivogen ...
-
bioRxiv - Immunology 2024Quote: ... The medium was also supplemented with 10 U/ml of DNaseI and 2 ng/mL of recombinant IL-15 (Peprotech). The cell suspension was transferred to a T25 flask (Corning ...
-
bioRxiv - Immunology 2024Quote: ... Approximately 5 × 106 NK cells were co-cultured with 1 × 107 of the modified and irradiated K562 feeder cells in 40 mL of Complete NK MACS medium supplemented with 100 U/mL of recombinant IL-2 (Peprotech) in a T75 flask (Corning) ...
-
bioRxiv - Physiology 2023Quote: ... protein from transfected THP-1-derived macrophages and human cardiac fibroblasts treated with macrophage supernatant or with recombinant human HB-EGF (100 ng/ml, 30min, #100-47, PeproTech) was isolated ...
-
bioRxiv - Neuroscience 2023Quote: ... Cells were replated onto glass coverslips at day 12 of the differentiation in N2/B27 medium supplemented with four recombinant growth factors at 25ng/ml (BDNF; ThermoFisher, NT3, NGF, GDNF; Peprotech). CHIR90221 was included for 4 further days ...
-
bioRxiv - Immunology 2023Quote: ... supplemented with 5% heat-inactivated fetal bovine serum (Biosera FB-1001) and 50ng/ml recombinant M-CSF (Peprotech 300-25). Differentiated macrophages were plated at a density of 1 x 106ml in the appropriate cell culture plate at least 1 d prior to stimulation.
-
bioRxiv - Cancer Biology 2023Quote: ... Cells were passed through 70-micron cell strainer and subsequently cultured 10mL complete RPMI media supplemented with 20 ng/mL of recombinant murine M-CSF (576406; BioLegend, 315-02 PeproTech). On day 3 ...
-
bioRxiv - Microbiology 2023Quote: ... 1 x 106 BLaER1 cells per well of a 6-well tissue culture plate were treated with 10 ng/ml human recombinant M-CSF and IL-3 (PeproTech) and 100 nM β-estradiol (Sigma-Aldrich ...
-
bioRxiv - Cell Biology 2023Quote: ... cells were either given fresh MC medium or cultured in basal MC medium (1% FBS) or in basal MC medium supplemented with 50ng/mL recombinant human VEGF-A165 (100-20; Peprotech) and culture for another 3 days.
-
bioRxiv - Bioengineering 2023Quote: ... At Day 11 the cytokine composition of the media was changed to 10ng/μl of bFGF and human recombinant Hepatocyte Growth Factor (HGF) at 10ng/μl (Peprotech). From Day 15 onwards ...
-
bioRxiv - Neuroscience 2023Quote: ... Astrocytes were then cultured with and without 14 x 103 LNCs/well and treated with 10 ng/mL recombinant murine IFNγ (Peprotech), 100 nM PD-1/PD-L1 inhibitor (Thomas Scientific ...
-
bioRxiv - Immunology 2023Quote: Primary Keratinocytes from three donors were seeded in 24-well plates and stimulated with KGM Media supplemented either with 0.1 ng/ml or 10 ng/ml of recombinant human IFN-γ (PeproTech), or infected with T ...
-
bioRxiv - Immunology 2023Quote: ... cells were washed and then expanded and differentiated in complete IMDM (as above) containing 20 ng/mL recombinant human IL-2 (Peprotech) for a further 4 days ...
-
bioRxiv - Molecular Biology 2024Quote: SP2/O-Ag14 myeloma and primary clones of hybridomas were cultured in GIT medium (catalog no. 63725715, Wako) supplemented with recombinant human interleukin-6 (IL-6) (catalog no. 20006, PeproTech). Cells were cultured in a humidified atmosphere containing 5% CO2 at 37°C and sub-cultured every day ...
-
bioRxiv - Immunology 2023Quote: ... Bone marrow-derived dendritic cells (BMDCs) were generated in tissue culture using recombinant GM-CSF (Peprotech, Cat. AF-315-03). Class B CpG 1826 oligonucleotide was synthesized by Integrated DNA Technologies ...
-
bioRxiv - Cancer Biology 2023Quote: ... Differentiation of BM cells into DCs was carried out in low attachment 10 mm cell culture dish in presence of bone marrow-differentiation media in presence of recombinant murine Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) (Cat. 315-03, Peprotech) for 48 a ...
-
bioRxiv - Immunology 2023Quote: ... Cultures were changed on day 4 to new complete RPMI 1640 medium containing recombinant murine IL-5 (10 ng/ml, Peprotech) and further fed with IL-5 every other day between days 10 to 14 ...
-
bioRxiv - Immunology 2024Quote: ... Bone marrow was stimulated with recombinant murine IL-3 (10 ng/mL) and IL-6 (10 ng/mL) (Peprotech, 21616) for 48 hours ...
-
bioRxiv - Immunology 2024Quote: ... 1×106 differentiated iRBCs or undifferentiated HUDEP-2 cells were stimulated with 50 ng/mL recombinant human interferon-gamma (PeproTech) for 6 hours ...
-
bioRxiv - Immunology 2024Quote: ... Isolated cells were assayed immediately or cultured overnight in StemSpan SFEM (STEMCELL) with 50 ng/mL recombinant human stem cell factor (PeproTech), 10-6 M dexamethasone (Sigma) ...
-
bioRxiv - Developmental Biology 2024Quote: ... On day 11 the cytokine composition of the media was changed to 10ng/ml of bFGF and human recombinant Hepatocyte Growth Factor (HGF) at 10ng/ml (Peprotech). From day 15 onwards ...
-
bioRxiv - Cell Biology 2024Quote: ... 5 µM A83-01 without EGF (HOME0) or with 0.1-50 ng/mL human recombinant EGF (Peprotech, Cranbury, NJ, USA) (HOME0.1 ...
-
bioRxiv - Immunology 2024Quote: ... filtered and cultured for 7 days in complete RPMI medium (RPMI-1640 medium containing L-glutamine plus 10% fetal calf serum) containing 20ng/mL recombinant GM-CSF (Peprotech).
-
bioRxiv - Immunology 2024Quote: ... Cells were plated in DMEM containing 10% v/v FBS and 10 ng/ml recombinant M-CSF (Peprotech #315-02). Cells were plated at a concentration of ∼150,000 cells per cm2 on non- treated Petri plates ...
-
bioRxiv - Immunology 2024Quote: ... For Th1 polarization T lymphocytes were cultured with 5 ng/ml of recombinant murine IL-12 (Peprotech, catalog 210-12). For stimulation of preactivated T lymphocytes with type I IFN ...
-
bioRxiv - Developmental Biology 2024Quote: ... All proteins were purchased from Peprotech.
-
bioRxiv - Immunology 2021Quote: ... when the cells were stimulated with 1000 U/ml of rhIL-2 and the combination of 10 ng/ml of recombinant murine (rm) IL-12 (210-12, PeproTech Inc) and 40 ng/ml of rm IL-15 (210-15 ...