Labshake search
Citations for Peprotech :
1201 - 1250 of 1425 citations for Recombinant PvCSPAII CT Protein since 2019
Citations are collected from bioRxiv only, the total number of publications could be much larger.
-
bioRxiv - Cell Biology 2020Quote: ... Enteroendocrine cell reporter organoids were derived from the proximal small intestine of Neurog3-RFP mice (expressing RFP under the Neurog3 promoter) and cultured as described above using recombinant murine Noggin (100ng/ml, Peprotech) and 10% R-Spondin conditioned medium ...
-
bioRxiv - Biochemistry 2022Quote: ... HeLa cells at a plate confluence of 80% were treated for 10 min with 100 ng/mL animal-free recombinant human EGF (PeproTech) or Gibco™ distilled water (Thermo Fisher Scientific ...
-
bioRxiv - Cancer Biology 2022Quote: PDAC cells were seeded in a 6-well plate and after 24 hours were treated with 10 ng/ml of recombinant TGF-β1 (rTGF-β1, Peprotech) either alone or in the presence of 80 μM of Vactosertib (Vacto ...
-
bioRxiv - Molecular Biology 2022Quote: ... The isolated cells were cultured in RPMI medium supplemented with 20% (v/v) FBS and 100 ng/mL human recombinant IL-2 (Peprotech). Two days prior to transduction ...
-
bioRxiv - Microbiology 2022Quote: ... 1 × 106 BlaER1 cells per well of a 6-well tissue culture plate were treated with 10 ng/ml human recombinant M-CSF and IL-3 (PeproTech) and 100 nM β-estradiol (Sigma-Aldrich ...
-
bioRxiv - Immunology 2022Quote: ... 0.25 µg/mL Amphotericin B and 2 mM L-glutamine and treated with 10 ng/mL recombinant IL-12p70 (Peprotech) for 24 hours for supernatant IFN-γ analysis.
-
bioRxiv - Immunology 2022Quote: ... OT-I T cells were maintained inactivated in vitro (‘No TCR’ condition) with recombinant mouse IL-7 (Peprotech, 10ng/ml). For IL-2 replenishment experiments ...
-
bioRxiv - Microbiology 2020Quote: ... The cells were cultured in RPMI 1640 (Nissui) supplemented with 10% heat-inactivated calf serum (Biowest) and 1 ng/mL recombinant human interleukin 6 (IL-6, PeproTech). HeLa and 293T cells were cultured in DMEM (Nacalai tesque ...
-
bioRxiv - Bioengineering 2021Quote: ... were isolated from blood of a healthy donors by density-gradient centrifugation and grown in RPMI 1640 medium supplemented with 10% FCS and 1000 U/ml recombinant IL-2 (PeproTech) and activated with 1 μg/ml anti-CD3 and anti-CD28 antibodies ...
-
bioRxiv - Immunology 2022Quote: ... the cells were supplemented with murine rIFN-γ (40 μg/ml) (Recombinant Murine IFN-γ, Catalog Number:315-05, Peprotech) or were kept unaltered ...
-
bioRxiv - Immunology 2022Quote: ... After a one hour resting period cells were transferred to 24-well plates and incubated for three days in medium containing 10U/mL recombinant human IL-2 (Peprotech) to allow establishment of the knockout ...
-
bioRxiv - Immunology 2022Quote: ... The BM cells per animal were resuspended in growth medium and cultured at 1-2 x 106 cells/mL on sterile 6-well plates for 9 days in the presence of 200ng/ml recombinant murine Flt3-Ligand (Peprotech). The BM cells were maintained at 37°C in 5% CO2 ...
-
bioRxiv - Physiology 2022Quote: ... NRK-49 cells whose culture medium was supplemented with 400pg/mL of recombinant human IL-1β (PeproTech, Cranbury, NJ, USA) and 1×10-7M Angiotensin II acetate human (Sigma) ...
-
bioRxiv - Cell Biology 2019Quote: ... monocytes were also conditioned in presence of 20 ng/mL M-CSF and 10 ng/mL recombinant human IL-10 (PeproTech) or 10 U/mL of IFNβ (Peprotech) ...
-
bioRxiv - Systems Biology 2020Quote: ... Cells were grown to at least 500,000 cells/mL before treatment with 20 ng/mL recombinant human tumor necrosis factor α (TNF) (Peprotech), 300 nM A-485 (Structural Genomics Consortium) ...
-
bioRxiv - Microbiology 2020Quote: ... On DIV 10 add 100% N2 medium plus recombinant human Brain Derived Neurotrophic Factor 10ng/ml (BDNF 450-02; Peprotech); Glial-Derived Neurotrophic Factor 10ng/ml (GDNF 450-10 ...
-
bioRxiv - Immunology 2019Quote: ... Differentiation was achieved with recombinant human GM-CSF (40 ng/mL) and human IL-4 (40ng/mL, both from PeproTech). After 5 days ...
-
bioRxiv - Immunology 2021Quote: ... 1-5 × 105 PBMCs were stimulated with 1 μg/ml of S864-882 for 10 days and recombinant human IL-2 (1 ng/ml, Peprotech) was added at day 4 and day 7 ...
-
bioRxiv - Immunology 2019Quote: ... 50μM 2-ME and 100ng/ml recombinant murine macrophage colony stimulating factor (M-CSF, PeproTech Inc., Rocky Hill, NJ, USA) for 6 days ...
-
bioRxiv - Microbiology 2019Quote: ... Purified CD14+ monocytes were cultured in complete RPMI supplemented with 100ng/mL each of recombinant human IL-4 and GM-CSF (PeproTech) at a cell density of 2e6 cells/mL ...
-
bioRxiv - Cell Biology 2021Quote: Primary mouse AT2 cells were isolated from homozygous H991A adult (mice 6-8 weeks) and cultured in BEGM plus 10% charcoal-stripped FBS and recombinant human KGF (10 ng/ml, Peprotech) on top of a thin substrate of 70% Cultrex (Trevigen)/30% rat tail collagen (Advanced Biomatrix ...
-
bioRxiv - Cell Biology 2020Quote: ... After 2 days of culture with 20 ng/ml M-CSF and 20 ng/ml recombinant human RANKL (PeproTech, UK), the wells were rinsed twice with PBS and incubated with 10% bleach solution for 30 min at room temperature ...
-
bioRxiv - Cell Biology 2020Quote: ... lines were maintained in StemFiT AK02 media (Ajinomoto) supplemented with 100 ng/ml recombinant human basic fibroblast growth factor (bFGF, Peprotech) (hereafter F/A media ...
-
bioRxiv - Neuroscience 2022Quote: ... TrkB-Fc (1μg/ml; R and D Systems, Minneapolis, MN) and recombinant BDNF (75-100ng/ml; PeproTech, Rockyhill, NJ; [18]) were added 5 min prior to stimulation.
-
bioRxiv - Developmental Biology 2020Quote: ... treated with 5 ng/ml recombinant (r) human TGFβ1 derived from HEK293 cells (100-21, PeproTech, Rocky Hill, NJ, USA) for 1 ...
-
bioRxiv - Cancer Biology 2021Quote: ... emerging hematopoietic cells and EBs were cultivated in SFM ((Liu et al. 2015) supplemented with recombinant human 10 ng fiblroblast growth factor type 2 (rhFGF-2, Peprotech), recombinant human 50 ng/mL rhSCF and 30 ng/mL rhIL-3 ...
-
bioRxiv - Cancer Biology 2021Quote: ... supplemented only with 100 ng/ml recombinant human stem cell factor (rhSCF, Milteny Biotech) and 30 ng/ml recombinant human interleukin 3 (rh IL-3, both Peprotech).
-
bioRxiv - Molecular Biology 2021Quote: ... 2-day cultured activated cells were washed and then cultured for 2 days in culture media supplemented with 20ng/mL recombinant human IL-2 (PeproTech) in the presence or absence of 10μM GC7 (Merck Chemicals) ...
-
bioRxiv - Molecular Biology 2021Quote: ... in 96-well plates (5.0 x 105 cells/well) and incubated with DMEM containing 10% FCS in the presence of 100 ng/ml recombinant murine RANKL (PeproTech) with 20 ng/ml recombinant murine M-CSF (PeproTech) ...
-
bioRxiv - Immunology 2021Quote: ... Forty-eight hours later cells were lifted off the plates and cultures were supplemented with 100 U/ml recombinant human IL-2 (Peprotech). CFSE labeling for certain experiments was performed prior to seeding on tissue culture plates.
-
The skin environment controls local dendritic cell differentiation and function through innate IL-13bioRxiv - Immunology 2021Quote: ... were harvested and one million cells were resuspended in 1 mL of TCM in 24 wells plates and stimulated with recombinant mouse IL-13 (Peprotech) at a concentration of 100 ng/mL for 30 min at 37°C ...
-
bioRxiv - Microbiology 2021Quote: ... cells were treated with recombinant mouse IFNβ (1000 U/ml, Stratech) or IL-10 (250 ng/ml, catalogue 210-10 Peprotech) 3 h prior to collection for immunoblotting.
-
bioRxiv - Immunology 2020Quote: ... approximately 2 x 106 cells were then seeded per 100 mm plate in 10 ml of media containing 20 ng/ml of recombinant murine (rm) GM-CSF (Peprotech). On day 3 ...
-
bioRxiv - Immunology 2021Quote: ... or medium alone for 6 h or with murine recombinant Interleukin–4 (rIL-4, 20 ng/mL, PeproTech EC Ltd.) for 24 h and analysed for MΦ activation markers by flow cytometry.
-
bioRxiv - Developmental Biology 2020Quote: ... heat-inactivated FCS, L-glutamine, penicillin/streptomycin) supplemented with murine recombinant cytokines (SCF, IL3 and Flt3) each at 100 ng/ml (PeproTech) and various concentrations of Aplnr ligand peptides including Apelin 36 (LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF) ...
-
bioRxiv - Cell Biology 2021Quote: ... bone marrows were cultured and in vitro differentiated in bone marrow differentiation medium containing 40 ng/ml recombinant murine M-CSF (PeproTech) as described before (Sun et al. ...
-
bioRxiv - Microbiology 2021Quote: ... the viral suspension was removed and replaced via 100 μL of NDM or NDM supplemented with 100 ng/mL of recombinant human IL-1β (200-01B, Peprotech), IL-6 (200-06 ...
-
bioRxiv - Immunology 2022Quote: Bone marrow cells from femurs and tibias were cultured in presence of 100 ng/ml recombinant human FLT3-L (Peprotech). After three days of differentiation ...
-
bioRxiv - Developmental Biology 2022Quote: ... #D1-011) according to manufacturer instructions by supplementing with 200 ng/ml human recombinant Sonic Hedgehog (Peprotech, Cat. #100-45) from day 0-10 and passaging cells at day 0 ...
-
bioRxiv - Immunology 2022Quote: Primary neuronal cells (DIV14) or oligodendrocytes were stimulated with 100 ng/μl of recombinant murine IL-12p70 (#210-12, Peprotech) for 5 min ...
-
bioRxiv - Immunology 2022Quote: ... primary neuronal cells were stimulated with 30 ng/μl or 100 ng/μl of Recombinant Murine IL-12p70 (#210-12, Peprotech) for 18 hours ...
-
bioRxiv - Immunology 2022Quote: ... or into bone marrow-derived dendritic cells (BMDC) in cRPMI supplemented with recombinant mouse IL-4 and GM-CSF (Peprotech). Influenza virus strains A/California/04/2009 (H1N1) ...
-
bioRxiv - Immunology 2022Quote: ... Bone marrow cells isolated from the bones of adult C57BL/6J mice were differentiated into bone marrow-derived macrophages (BMM) in cDMEM supplemented with recombinant mouse M-CSF (Peprotech) or into bone marrow-derived dendritic cells (BMDC ...
-
bioRxiv - Bioengineering 2022Quote: ... the spheroids were then transferred to spinal cord medium II (ScM II) with 10 nM retinoic acid and 5 ng/mL recombinant human BMP4 (Peprotech) for the next 6 days ...
-
bioRxiv - Neuroscience 2023Quote: ... iSNs were treated with 10% plasma or 100ng/mL recombinant human ET1 (R&D, #1160) or CCL2 (PeproTech, #300-04) diluted in iSN maturation media for 30 minutes at 37°C ...
-
bioRxiv - Immunology 2022Quote: ... Th2 cells were generated by activating naïve CD4+ T cells with 1 μg/mL anti-CD3ε/3 μg/mL anti-CD28 for 3 days in complete T cell medium supplemented with 250U recombinant IL-4 (PeproTech), 6 μg/mL anti-IL-12 (BioXcell) ...
-
bioRxiv - Physiology 2024Quote: ... the digested cells were first incubated in RPMI 1640 with 10% FBS and 10 ng/ml recombinant murine IL-7 (PeproTech), and stimulated with 50 ng/ml phorbol 12-myristate 13-acetate ...
-
bioRxiv - Cancer Biology 2024Quote: ... at 3:1 bead: T-cell ratio together with human recombinant IL-15 and IL-7 (PeproTech; 5 ng/mL) in AIM-V medium supplemented with 5% FBS ...
-
bioRxiv - Cancer Biology 2024Quote: ... according to manufacturer’s specifications in the presence of 100 IU/mL recombinant human (rh) IL-2 and 10 ng/mL rhIL-7 (Peprotech). Spinoculation with neat 293 Galv9 retroviral supernatant was performed at 48 ...
-
bioRxiv - Immunology 2024Quote: ... Cells were expanded for at least 1 week in the presence of IL-3 and 30 ng/mL recombinant SCF (Peprotech) to obtain peritoneal cavity-derived mast cells (PCMCs) ...